Lus10016819 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016821 161 / 5e-52 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G218622 39 / 0.0004 ND /
PFAM info
Representative CDS sequence
>Lus10016819 pacid=23179041 polypeptide=Lus10016819 locus=Lus10016819.g ID=Lus10016819.BGIv1.0 annot-version=v1.0
ATGGCACCTCCTCAAGCAAACAAATTCATGAGGATTGCTGAAGAAGGCTTTTCCCTCATCGACAACGGCTACTACGGCGGCCCCAGCGGAGGCTATTATT
CTTCAGCAGTCCACCGCCGTAGTAGTAGTACTGCTCATCATTATGCGGCCCAATACCAAACCGACCAATATCAGACCGAACAGAAGCAGTCGTTCATCTA
TTACTGTCCTCGTATGTCGACCACCACGGTAAGGATTCCGGCGGCGAAGGAGGGGATTCGTAATTACCAGAGCAGCCGAGTGCCGGCGGCGGCAAGGATG
GCGGAGCGGGTGATGACGAGTGACGAGGCGGCCCAGAAGTTTGGTGGGTTTGTCGTTGTGGACCACGGTTCAAGAAGGCGTTCTTCTAAGTGGGGCTTTT
GA
AA sequence
>Lus10016819 pacid=23179041 polypeptide=Lus10016819 locus=Lus10016819.g ID=Lus10016819.BGIv1.0 annot-version=v1.0
MAPPQANKFMRIAEEGFSLIDNGYYGGPSGGYYSSAVHRRSSSTAHHYAAQYQTDQYQTEQKQSFIYYCPRMSTTTVRIPAAKEGIRNYQSSRVPAAARM
AERVMTSDEAAQKFGGFVVVDHGSRRRSSKWGF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10016819 0 1
AT5G59190 subtilase family protein (.1) Lus10004682 4.7 0.8398
AT1G07250 UGT71C4 UDP-glucosyl transferase 71C4 ... Lus10010476 8.1 0.8125
AT2G44450 BGLU15 beta glucosidase 15 (.1) Lus10031235 11.8 0.8614
AT4G05230 Ubiquitin-like superfamily pro... Lus10007641 15.1 0.8366
AT5G59320 LTP3 lipid transfer protein 3 (.1) Lus10042210 19.8 0.8173
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10033581 20.4 0.8258
AT3G50845 Protein of unknown function (D... Lus10014311 23.4 0.8210
AT3G02645 Plant protein of unknown funct... Lus10033668 25.0 0.7550
AT3G02100 UDP-Glycosyltransferase superf... Lus10015746 25.3 0.8142
Lus10025503 25.7 0.8108

Lus10016819 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.