Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48420 105 / 5e-29 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) AT4G39970 46 / 2e-07 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) AT5G45170 42 / 6e-06 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033034 [exp] 142 / 2e-43 AT3G48420 424 / 4e-150 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Lus10013663 [exp] 141 / 6e-43 AT3G48420 427 / 4e-151 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Lus10000633 [exp] 51 / 4e-09 AT4G39970 427 / 1e-151 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Lus10023149 [exp] 51 / 4e-09 AT4G39970 423 / 4e-150 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Lus10018280 [exp] 37 / 0.0008 AT5G45170 410 / 1e-136 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G088500 [exp] 111 / 3e-31 AT3G48420 434 / 5e-154 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Potri.014G003916 [exp] 77 / 2e-20 AT3G48420 87 / 2e-22 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Potri.007G095200 [exp] 49 / 4e-08 AT4G39970 439 / 3e-156 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Potri.015G112500 [exp] 42 / 1e-05 AT5G45170 386 / 2e-133 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Potri.013G007800 [exp] 37 / 0.0006 AT1G56500 1489 / 0.0 haloacid dehalogenase-like hydrolase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016820 pacid=23179045 polypeptide=Lus10016820 locus=Lus10016820.g ID=Lus10016820.BGIv1.0 annot-version=v1.0 ATGTATACATCCCATCCCATCCACTTATCCAACAGCTGCGTAGTAATAGAGGACAGTGGAATAGGACTTGCAGCAGCTAAAGCAGCAGGAATGAAATGTA TAATCACAAAGAGCGGGTACACAGCTGAGGAGGACTTCTTGAATGCAGACGCAGTGTTTGATTTCATTGGAGACCCACCAGAAGAACGATTTGACTTTGA CTTCTGTGCTAGCCTTGTTGAGAAGCAATATGTGAGCTAA
AA sequence Show only first row Show all	>Lus10016820 pacid=23179045 polypeptide=Lus10016820 locus=Lus10016820.g ID=Lus10016820.BGIv1.0 annot-version=v1.0 MYTSHPIHLSNSCVVIEDSGIGLAAAKAAGMKCIITKSGYTAEEDFLNADAVFDFIGDPPEERFDFDFCASLVEKQYVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48420			Haloacid dehalogenase-like hyd...		Lus10016820 [exp]	0	1
AT3G48420			Haloacid dehalogenase-like hyd...		Lus10033034 [exp]	1.0	0.9857
AT4G36020		CSDP1	cold shock domain protein 1 (....		Lus10028073 [exp]	1.4	0.9694
AT1G17930			Aminotransferase-like, plant m...		Lus10000686 [exp]	2.6	0.9386
AT1G52240		PIRF1, ATROPGEF...	phytochrome interacting RopGEF...		Lus10021496 [exp]	3.0	0.9508
AT2G41290		SSL2	strictosidine synthase-like 2 ...		Lus10012095 [exp]	7.3	0.9100
AT1G08380		PSAO	photosystem I subunit O (.1)		Lus10013310 [exp]	8.2	0.9476
AT1G32220			NAD(P)-binding Rossmann-fold s...		Lus10000057 [exp]	9.9	0.9055
AT1G52230		PSAH2, PSAH-2, ...	PHOTOSYSTEM I SUBUNIT H-2, pho...		Lus10035864 [exp]	11.8	0.9457
AT4G12010			Disease resistance protein (TI...		Lus10042778 [exp]	12.3	0.9000
AT5G64260		EXL2, MSJ1.10	EXORDIUM like 2 (.1)		Lus10013789 [exp]	13.1	0.8913

Compare expression of checked genes

Lus10016820 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.