Lus10016821 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016819 144 / 2e-45 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G218622 39 / 0.0004 ND /
PFAM info
Representative CDS sequence
>Lus10016821 pacid=23179056 polypeptide=Lus10016821 locus=Lus10016821.g ID=Lus10016821.BGIv1.0 annot-version=v1.0
ATGGAACCACCTCAAGCAAACAAATTCATGGGGATTGCTGAAGATGGCTTTTCCCTCATCGAAAACGGATACTACGGCGGTGGCAGCGGTGGAGGCTATT
CTTCTTCGGCGGCAGTCCATCGCCGTAGTAGTAGTACTGCGCATCATTATGCGGCCCAGTACCAAACCTACCAATATCAGACCGAACAGCAGCAGCCGTT
CATCTATTACTGTCCTCGTATGTCGACCACCACGGTAAAGGTTCCGGCGGCGACGGAGGGGATTCGGTATTACCAGAGCAGCCGAGTGCCGGCGGCGGAG
CGGGTGATGACGAGCGACGAGGCGGCCCAGAAGTTCGGTGGGTTTGTCGTTGTGGATCACGGTGCTAAAAGGCGGTCTTCTAAGTGGGGCTTTTGA
AA sequence
>Lus10016821 pacid=23179056 polypeptide=Lus10016821 locus=Lus10016821.g ID=Lus10016821.BGIv1.0 annot-version=v1.0
MEPPQANKFMGIAEDGFSLIENGYYGGGSGGGYSSSAAVHRRSSSTAHHYAAQYQTYQYQTEQQQPFIYYCPRMSTTTVKVPAATEGIRYYQSSRVPAAE
RVMTSDEAAQKFGGFVVVDHGAKRRSSKWGF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10016821 0 1
AT5G01750 Protein of unknown function (D... Lus10009093 1.4 0.8917
Lus10033211 2.8 0.8652
AT1G30590 RNA polymerase I specific tran... Lus10018154 4.0 0.8780
Lus10036407 5.6 0.8189
AT3G05327 Cyclin family protein (.1) Lus10004475 8.7 0.8250
AT5G22390 Protein of unknown function (D... Lus10004863 17.1 0.8601
Lus10019472 17.1 0.8726
Lus10031014 19.6 0.8539
AT3G48200 unknown protein Lus10002461 19.9 0.8513
AT1G27180 disease resistance protein (TI... Lus10018309 22.0 0.8337

Lus10016821 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.