Lus10016822 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G78400 93 / 2e-22 Pectin lyase-like superfamily protein (.1)
AT1G43080 85 / 1e-19 Pectin lyase-like superfamily protein (.1)
AT2G15460 85 / 1e-19 Pectin lyase-like superfamily protein (.1)
AT2G15450 85 / 1e-19 Pectin lyase-like superfamily protein (.1)
AT1G43090 85 / 2e-19 Pectin lyase-like superfamily protein (.1)
AT3G07970 85 / 2e-19 QRT2 QUARTET 2, Pectin lyase-like superfamily protein (.1)
AT2G26620 84 / 2e-19 Pectin lyase-like superfamily protein (.1)
AT2G33160 82 / 1e-18 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein (.1)
AT2G40310 82 / 2e-18 Pectin lyase-like superfamily protein (.1)
AT1G43100 82 / 2e-18 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012489 94 / 1e-22 AT1G02790 307 / 6e-101 polygalacturonase 4 (.1)
Lus10003782 91 / 2e-21 AT1G02790 323 / 4e-107 polygalacturonase 4 (.1)
Lus10002931 81 / 4e-18 AT3G07820 233 / 6e-73 Pectin lyase-like superfamily protein (.1)
Lus10002125 80 / 1e-17 AT3G59850 509 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10011418 79 / 3e-17 AT2G43870 499 / 2e-177 Pectin lyase-like superfamily protein (.1)
Lus10043088 76 / 2e-16 AT3G07820 360 / 6e-123 Pectin lyase-like superfamily protein (.1)
Lus10011419 76 / 2e-16 AT2G43870 507 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10013783 72 / 4e-16 AT3G07820 85 / 1e-19 Pectin lyase-like superfamily protein (.1)
Lus10026183 74 / 7e-16 AT2G33160 305 / 2e-100 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G007300 152 / 1e-44 AT4G18180 289 / 2e-94 Pectin lyase-like superfamily protein (.1)
Potri.010G011100 149 / 1e-43 AT1G02790 295 / 1e-96 polygalacturonase 4 (.1)
Potri.010G011200 139 / 1e-39 AT1G02790 300 / 1e-98 polygalacturonase 4 (.1)
Potri.002G202200 100 / 2e-25 AT1G02790 400 / 7e-138 polygalacturonase 4 (.1)
Potri.002G202100 100 / 2e-25 AT1G02790 399 / 2e-137 polygalacturonase 4 (.1)
Potri.009G038100 86 / 5e-20 AT1G78400 357 / 4e-121 Pectin lyase-like superfamily protein (.1)
Potri.009G169100 79 / 2e-17 AT4G18180 563 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.010G177601 75 / 6e-16 AT1G65570 491 / 3e-174 Pectin lyase-like superfamily protein (.1)
Potri.007G144100 73 / 2e-15 AT2G43870 525 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.010G177501 72 / 4e-15 AT1G65570 491 / 3e-174 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence
>Lus10016822 pacid=23179122 polypeptide=Lus10016822 locus=Lus10016822.g ID=Lus10016822.BGIv1.0 annot-version=v1.0
ATGGCGGGAACGTTGGAGATTACTCAGGCGACCACCACCTCCGCCCTTCTTTTATTCGTCATTCTCGCCGCCGTTTGTTCTTCCGTGCAGCCACAGCCAC
ATCACCCCCACCACCATAGCCATAGGGATCCCAACGAGAAGGTCTTCAACATCCTTCACTTTGGCGCCAAGCCCGGCGCCAAGCACGATGCTTCCTTGAA
CATAATGAAGGCGTTCAGGGCGGCGTGTCTGACGCCGGGAAGTGTGAGGTTGGTAATACCGGCGGGGGAGTTTTTGGCCGGAATGATGGTGTTCTCAGGG
CCATGCAAAGCAAGACATATTATGTTTCAGGTTGTGGGGAACTTGAAAGCAGTCGACGACCCGTCGGTTTACCCGGAGGATTTCTGGATGTCGTTTGAAG
GTGTTGACGGACTCATCGTTTGCGGCAGAGGTACCGTTGACGGTCAAGGGCAGAAGATGTGGCCGTTTAACGACGGCGGTGGCTCTTCTTTCCCCGCTTT
TCTTCCCCCGCCGTTTTTTCATGAACCGAGTTGA
AA sequence
>Lus10016822 pacid=23179122 polypeptide=Lus10016822 locus=Lus10016822.g ID=Lus10016822.BGIv1.0 annot-version=v1.0
MAGTLEITQATTTSALLLFVILAAVCSSVQPQPHHPHHHSHRDPNEKVFNILHFGAKPGAKHDASLNIMKAFRAACLTPGSVRLVIPAGEFLAGMMVFSG
PCKARHIMFQVVGNLKAVDDPSVYPEDFWMSFEGVDGLIVCGRGTVDGQGQKMWPFNDGGGSSFPAFLPPPFFHEPS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G78400 Pectin lyase-like superfamily ... Lus10016822 0 1

Lus10016822 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.