Lus10016823 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02790 239 / 5e-77 PGA4 polygalacturonase 4 (.1)
AT4G18180 226 / 2e-72 Pectin lyase-like superfamily protein (.1)
AT3G14040 212 / 2e-66 Pectin lyase-like superfamily protein (.1)
AT3G07850 211 / 3e-66 Pectin lyase-like superfamily protein (.1)
AT3G07820 207 / 4e-65 Pectin lyase-like superfamily protein (.1)
AT3G07840 205 / 4e-64 Pectin lyase-like superfamily protein (.1)
AT3G07830 197 / 3e-61 Pectin lyase-like superfamily protein (.1)
AT3G59850 195 / 2e-60 Pectin lyase-like superfamily protein (.1)
AT5G48140 195 / 2e-60 Pectin lyase-like superfamily protein (.1)
AT1G65570 192 / 3e-59 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003782 223 / 1e-70 AT1G02790 323 / 4e-107 polygalacturonase 4 (.1)
Lus10012489 216 / 4e-68 AT1G02790 307 / 6e-101 polygalacturonase 4 (.1)
Lus10041059 209 / 2e-65 AT3G07830 310 / 1e-102 Pectin lyase-like superfamily protein (.1)
Lus10041058 209 / 4e-65 AT3G07830 311 / 1e-102 Pectin lyase-like superfamily protein (.1)
Lus10009606 204 / 9e-64 AT3G07840 323 / 4e-108 Pectin lyase-like superfamily protein (.1)
Lus10016824 204 / 2e-63 AT4G18180 281 / 7e-91 Pectin lyase-like superfamily protein (.1)
Lus10009605 203 / 1e-61 AT3G07840 317 / 1e-102 Pectin lyase-like superfamily protein (.1)
Lus10043088 197 / 1e-61 AT3G07820 360 / 6e-123 Pectin lyase-like superfamily protein (.1)
Lus10011418 198 / 2e-61 AT2G43870 499 / 2e-177 Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G007300 320 / 6e-109 AT4G18180 289 / 2e-94 Pectin lyase-like superfamily protein (.1)
Potri.010G011100 312 / 4e-106 AT1G02790 295 / 1e-96 polygalacturonase 4 (.1)
Potri.010G011200 306 / 2e-103 AT1G02790 300 / 1e-98 polygalacturonase 4 (.1)
Potri.002G202100 253 / 1e-82 AT1G02790 399 / 2e-137 polygalacturonase 4 (.1)
Potri.002G202200 253 / 1e-82 AT1G02790 400 / 7e-138 polygalacturonase 4 (.1)
Potri.009G169100 233 / 1e-74 AT4G18180 563 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.009G038100 216 / 9e-69 AT1G78400 357 / 4e-121 Pectin lyase-like superfamily protein (.1)
Potri.014G162300 205 / 6e-65 AT3G07850 358 / 3e-122 Pectin lyase-like superfamily protein (.1)
Potri.019G067133 205 / 3e-64 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067200 205 / 3e-64 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence
>Lus10016823 pacid=23179033 polypeptide=Lus10016823 locus=Lus10016823.g ID=Lus10016823.BGIv1.0 annot-version=v1.0
ATGAAGTTCATGAAGGTGAAGAACACGATCATAAAGCAGATAACATCGGTAAACCCGATGGGATTCCACATCGGAATCGTGCTCTCCCACAACGTACGAG
CCAAACACGTCCACCTCATCGCTCCAGAGGACAGCCCGAACACGGATGGGTTCCACATCAGCCAGTCGAGCCTCGTGAGAGTGACACGGAGCACCATCGA
GACAGGGGACGACTGCGTGGGGATCATCCATGGTTGCACCGATGTGGCGATCAAGAAGGTGTTCTGTGGGCCAGGGCACGGCATCAGCATCGGCAGCTTG
GGGAAGTACTCGGACGAGAAGGACGTCGTAGGTGTGACGGTGAAGAACTGCACGCTGAGGAAGACCGATAACGGAGTTAGGATCAAGACCTACGCTGGGT
CCCCTCCTAGCCAGGCTTCAAGGATGGTGTTTGAAGATATTGTGATGGAGGATGTTAAGCATCCCATCATTATTGATCAGCACTATGGCTCCAGCTCCAA
AGGGCCGTCGCAGGTGAAGATCAGCGACATCCAGTTCAATAACATAAGGGGGACCACCATCTCAGACGTCGGGATTTTGCTCGATTGCAGCGAGAAGGTG
CCCTGCGAAGGAGTTCGATTCTCCAACGTTGATCTCAAGTACAGTGGAACAAGCAAGACCAAGCCTTTCGTGACTAGTTGTGCCAATGCTAAGGCCAGCT
TCAATGGCCTCAAATCCCCACCTCCTTGCCACGCTTAA
AA sequence
>Lus10016823 pacid=23179033 polypeptide=Lus10016823 locus=Lus10016823.g ID=Lus10016823.BGIv1.0 annot-version=v1.0
MKFMKVKNTIIKQITSVNPMGFHIGIVLSHNVRAKHVHLIAPEDSPNTDGFHISQSSLVRVTRSTIETGDDCVGIIHGCTDVAIKKVFCGPGHGISIGSL
GKYSDEKDVVGVTVKNCTLRKTDNGVRIKTYAGSPPSQASRMVFEDIVMEDVKHPIIIDQHYGSSSKGPSQVKISDIQFNNIRGTTISDVGILLDCSEKV
PCEGVRFSNVDLKYSGTSKTKPFVTSCANAKASFNGLKSPPPCHA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G02790 PGA4 polygalacturonase 4 (.1) Lus10016823 0 1
AT1G09380 nodulin MtN21 /EamA-like trans... Lus10031437 10.7 0.6432
Lus10032997 32.6 0.6161
Lus10004795 33.0 0.5506
Lus10026392 34.6 0.6209
AT4G33355 Bifunctional inhibitor/lipid-t... Lus10029445 68.1 0.5540
AT1G26140 unknown protein Lus10034406 110.4 0.5468
AT3G54420 ATCHITIV, CHIV,... CHITINASE CLASS IV, homolog of... Lus10024367 155.5 0.5024
AT4G14103 F-box/RNI-like superfamily pro... Lus10020635 168.9 0.5151
Lus10029048 186.0 0.4759
AT5G58610 PHD finger transcription facto... Lus10015250 188.3 0.5051

Lus10016823 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.