Lus10016829 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G16780 333 / 9e-118 Ribosomal protein L19e family protein (.1)
AT4G02230 317 / 2e-111 Ribosomal protein L19e family protein (.1)
AT1G02780 311 / 4e-109 EMB2386 embryo defective 2386, Ribosomal protein L19e family protein (.1)
AT4G16030 70 / 2e-15 Ribosomal protein L19e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038417 332 / 3e-117 AT3G16780 348 / 9e-124 Ribosomal protein L19e family protein (.1)
Lus10037707 340 / 6e-117 AT3G16780 343 / 8e-118 Ribosomal protein L19e family protein (.1)
Lus10038418 316 / 3e-110 AT3G16780 337 / 3e-118 Ribosomal protein L19e family protein (.1)
Lus10023387 324 / 1e-109 AT3G16780 343 / 1e-116 Ribosomal protein L19e family protein (.1)
Lus10023388 306 / 2e-107 AT3G16780 324 / 2e-114 Ribosomal protein L19e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G140800 340 / 1e-120 AT3G16780 315 / 2e-110 Ribosomal protein L19e family protein (.1)
Potri.004G078000 335 / 2e-118 AT1G02780 309 / 4e-108 embryo defective 2386, Ribosomal protein L19e family protein (.1)
Potri.012G037500 331 / 1e-116 AT1G02780 317 / 2e-111 embryo defective 2386, Ribosomal protein L19e family protein (.1)
Potri.015G029500 330 / 1e-116 AT3G16780 309 / 5e-108 Ribosomal protein L19e family protein (.1)
Potri.015G037100 236 / 7e-80 AT1G02780 201 / 5e-66 embryo defective 2386, Ribosomal protein L19e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01280 Ribosomal_L19e Ribosomal protein L19e
Representative CDS sequence
>Lus10016829 pacid=23179098 polypeptide=Lus10016829 locus=Lus10016829.g ID=Lus10016829.BGIv1.0 annot-version=v1.0
ATGGTGTCGTTGAAACTCCAGAAGCGGCTTGCCGCCAGCGTGCTGAAGTGCGGGAAGGGAAAGGTCTGGCTTGATCCCAATGAGTGCAACGAACTCTCAA
TGGCCAACTCCAGGCAAAACATCAGGAAGCTGATTAGCGATGGCTTCATCATTAGGAAGCCGACCAATATCCATTCGAGGTCTCGTGCGCGAAGGATGAA
TGAGGCCAAGAGAAAGGGTCGCCACTCTGGATACGGTAAAAGGAAGGGTACAAGGGAGGCTAGGTTGCCGACCAAGATCCTGTGGATGAGGAGGATGCGA
GTCCTGAGGCGTCTTCTGCGCAAGTACCGTGAAGCCAAGAAGATTGACAGGCATATGTACCATGATATGTACATGAAGGTGAAAGGTAATGTTTTCAAGA
ACAAGCGTGTACTTATGGAGAGCATCCACAAGACCAAGGCTGAAAAGGCACGAGAGAAGACACTGTCTGATCAGTTTGAAGCTAAGCGTGCTAAGAACAA
GGCCAGCAGGGAGAGGAAGTTGGCAAGAAGAGAAGAGCGTTTTGCACAAGGACCTGGGGCGGAGAAGGCACAACCTACACCTGCACCTCAACAGACAGAG
GGAGCAAAGAAGAAGTCTAAGAAGTGA
AA sequence
>Lus10016829 pacid=23179098 polypeptide=Lus10016829 locus=Lus10016829.g ID=Lus10016829.BGIv1.0 annot-version=v1.0
MVSLKLQKRLAASVLKCGKGKVWLDPNECNELSMANSRQNIRKLISDGFIIRKPTNIHSRSRARRMNEAKRKGRHSGYGKRKGTREARLPTKILWMRRMR
VLRRLLRKYREAKKIDRHMYHDMYMKVKGNVFKNKRVLMESIHKTKAEKAREKTLSDQFEAKRAKNKASRERKLARREERFAQGPGAEKAQPTPAPQQTE
GAKKKSKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G16780 Ribosomal protein L19e family ... Lus10016829 0 1
AT3G16780 Ribosomal protein L19e family ... Lus10037707 1.0 0.9488
AT3G16780 Ribosomal protein L19e family ... Lus10038417 4.5 0.9417
AT1G04480 Ribosomal protein L14p/L23e fa... Lus10020499 6.0 0.9404
AT5G56710 Ribosomal protein L31e family ... Lus10015698 8.9 0.9415
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10023454 9.7 0.9425
AT5G56710 Ribosomal protein L31e family ... Lus10037703 11.6 0.9318
AT3G11940 AML1, ATRPS5A ARABIDOPSIS MINUTE-LIKE 1, rib... Lus10008436 12.2 0.9423
AT3G55280 RPL23A2, RPL23A... RIBOSOMAL PROTEIN L23A2, ribos... Lus10004942 14.0 0.9338
AT2G32060 Ribosomal protein L7Ae/L30e/S1... Lus10027800 15.4 0.9392
AT3G11510 Ribosomal protein S11 family p... Lus10022693 15.5 0.9389

Lus10016829 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.