Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037724 [exp] 161 / 1e-53 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T171001 [exp] 82 / 4e-22 ND / Potri.008G108801 [exp] 81 / 9e-22 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016852 pacid=23179085 polypeptide=Lus10016852 locus=Lus10016852.g ID=Lus10016852.BGIv1.0 annot-version=v1.0 ATGTCTTCGGACAAGGGCAATGTTGAGGAGCTGGAGGAGCCCTGCACCAGCAACAAACACGCAAGTCTTGCTGACAGAAAACCTAATGCACAAGGCACAG GGAATTCTGGTTTAGAGAGAGCGCTTGCACATAGAGCACTCTTTTGGTCACACAATGGCAGGGTGAAGGGGAGAAAATCTGTGAACAACATTGCCAGAAT GTTGCCAAGCAGGCTAAGCAAGGTATCCTTGGCAGATGATCCAGCTGACTAA
AA sequence Show only first row Show all	>Lus10016852 pacid=23179085 polypeptide=Lus10016852 locus=Lus10016852.g ID=Lus10016852.BGIv1.0 annot-version=v1.0 MSSDKGNVEELEEPCTSNKHASLADRKPNAQGTGNSGLERALAHRALFWSHNGRVKGRKSVNNIARMLPSRLSKVSLADDPAD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10016852 [exp]	0	1
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Lus10014175 [exp]	4.9	0.8170
AT4G38840			SAUR-like auxin-responsive pro...		Lus10032173 [exp]	11.8	0.7671
AT1G76140			Prolyl oligopeptidase family p...		Lus10034558 [exp]	14.9	0.7950
AT5G02390		DAU1	DUO1-activated unknown 1, Prot...		Lus10036009 [exp]	22.7	0.7722
AT2G02000		GAD3	glutamate decarboxylase 3 (.1)		Lus10009116 [exp]	23.5	0.7792
AT5G48840		ATPTS, PANC	ARABIDOPSIS THALIANA PANTOTHEN...		Lus10025932 [exp]	26.3	0.7550
AT5G08400			Protein of unknown function (D...		Lus10008997 [exp]	28.1	0.6717
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10028397 [exp]	29.7	0.7556
AT2G24450		FLA3	FASCICLIN-like arabinogalactan...		Lus10020158 [exp]	32.0	0.6943
AT1G55020		ATLOX1, LOX1	ARABIDOPSIS LIPOXYGENASE 1, li...		Lus10001465 [exp]	34.2	0.7018

Compare expression of checked genes

Lus10016852 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.