Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13910 45 / 6e-07 Protein of unknown function (DUF3511) (.1) AT2G47480 42 / 8e-06 Protein of unknown function (DUF3511) (.1) AT3G62640 41 / 2e-05 Protein of unknown function (DUF3511) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008471 [exp] 37 / 0.0008 AT2G19460 95 / 1e-26 Protein of unknown function (DUF3511) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G140800 [exp] 49 / 1e-08 AT2G47480 62 / 2e-14 Protein of unknown function (DUF3511) (.1) Potri.005G019900 [exp] 43 / 2e-06 AT3G05725 63 / 3e-14 Protein of unknown function (DUF3511) (.1) Potri.014G123600 [exp] 40 / 5e-05 AT2G47480 93 / 5e-26 Protein of unknown function (DUF3511) (.1) Potri.013G010600 [exp] 38 / 0.0002 AT2G47480 54 / 5e-11 Protein of unknown function (DUF3511) (.1) Potri.001G197700 [exp] 38 / 0.0003 AT2G19460 78 / 1e-19 Protein of unknown function (DUF3511) (.1) Potri.003G043600 [exp] 37 / 0.0005 AT5G11970 89 / 5e-24 Protein of unknown function (DUF3511) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12023 [flax] [poplar] DUF3511 Domain of unknown function (DUF3511)
Representative CDS sequence Show only first row Show all	>Lus10016853 pacid=23179127 polypeptide=Lus10016853 locus=Lus10016853.g ID=Lus10016853.BGIv1.0 annot-version=v1.0 ATGAAGGCGGCGAAAGAAACCATGAGGGAGATGGAAGAGTTCAGGAAGGCCAACGATCAAATGTACAACAACGTTGGCGAATGGAAGTACGAGCCCAGCT CGGCGCCCGGCGACAAGCATGTTTTCTCCCGAAACGTGGCCGTACAAGCTCCGGCGACGAGGTCCAATAAGATGATAGTGGTGGCGTCCACGATGCCTCC GTCGACAGTGGCCGTGACGGCTCCGAGGATGGCCAATAGCCACAAGGCGAGGGCCCAGAGGAGCGAGGGCGAATCGAAGAGGCAGAGGAGGGTGGTGAAA TACAAATCGTATGCCGTTGAAAGTAGGATGAGGGCTTCCGTTAACAGCGGCCTACGATGGTTCAAGAACCTTGTATGA
AA sequence Show only first row Show all	>Lus10016853 pacid=23179127 polypeptide=Lus10016853 locus=Lus10016853.g ID=Lus10016853.BGIv1.0 annot-version=v1.0 MKAAKETMREMEEFRKANDQMYNNVGEWKYEPSSAPGDKHVFSRNVAVQAPATRSNKMIVVASTMPPSTVAVTAPRMANSHKARAQRSEGESKRQRRVVK YKSYAVESRMRASVNSGLRWFKNLV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G13910			Protein of unknown function (D...		Lus10016853 [exp]	0	1
AT1G66230	MYB	ATMYB20	myb domain protein 20 (.1)		Lus10004042 [exp]	3.5	1.0000
					Lus10011962 [exp]	4.9	1.0000
AT2G20340			Pyridoxal phosphate (PLP)-depe...		Lus10012601 [exp]	6.0	1.0000
					Lus10022805 [exp]	6.9	1.0000
AT5G05530			RING/U-box superfamily protein...		Lus10024629 [exp]	7.7	1.0000
AT2G15220			Plant basic secretory protein ...		Lus10026579 [exp]	8.5	1.0000
AT2G36620		RPL24A	ribosomal protein L24 (.1)		Lus10014637 [exp]	8.8	1.0000
AT5G04350			Plant self-incompatibility pro...		Lus10029388 [exp]	9.8	1.0000
					Lus10030558 [exp]	10.4	1.0000
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Lus10030911 [exp]	10.5	1.0000

Compare expression of checked genes

Lus10016853 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.