Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G16910 79 / 3e-19 AAE7, ACN1 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1) AT2G17650 56 / 3e-11 AMP-dependent synthetase and ligase family protein (.1) AT5G16370 52 / 6e-10 AAE5 acyl activating enzyme 5 (.1) AT1G20560 50 / 5e-09 AAE1 acyl activating enzyme 1 (.1.2) AT1G76290 45 / 2e-07 AMP-dependent synthetase and ligase family protein (.1) AT5G16340 42 / 2e-06 AMP-dependent synthetase and ligase family protein (.1) AT1G77240 40 / 9e-06 AMP-dependent synthetase and ligase family protein (.1) AT1G21530 39 / 3e-05 AMP-dependent synthetase and ligase family protein (.1.2) AT1G21540 39 / 4e-05 AMP-dependent synthetase and ligase family protein (.1) AT1G66120 37 / 0.0002 AMP-dependent synthetase and ligase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037734 [exp] 94 / 1e-24 AT3G16910 897 / 0.0 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1) Lus10016869 [exp] 91 / 1e-23 AT3G16910 902 / 0.0 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1) Lus10016870 [exp] 80 / 1e-19 AT3G16910 918 / 0.0 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1) Lus10037735 [exp] 80 / 2e-19 AT3G16910 909 / 0.0 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1) Lus10039161 [exp] 57 / 1e-11 AT5G16370 781 / 0.0 acyl activating enzyme 5 (.1) Lus10013773 [exp] 56 / 5e-11 AT5G16370 422 / 1e-146 acyl activating enzyme 5 (.1) Lus10012266 [exp] 52 / 1e-09 AT5G16370 733 / 0.0 acyl activating enzyme 5 (.1) Lus10016011 [exp] 49 / 8e-09 AT1G20560 846 / 0.0 acyl activating enzyme 1 (.1.2) Lus10007369 [exp] 49 / 1e-08 AT1G65890 724 / 0.0 acyl activating enzyme 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G108000 [exp] 80 / 8e-20 AT3G16910 904 / 0.0 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1) Potri.005G250700 [exp] 56 / 2e-11 AT1G20560 790 / 0.0 acyl activating enzyme 1 (.1.2) Potri.002G010600 [exp] 55 / 7e-11 AT1G20560 823 / 0.0 acyl activating enzyme 1 (.1.2) Potri.019G067800 [exp] 54 / 1e-10 AT5G16370 799 / 0.0 acyl activating enzyme 5 (.1) Potri.015G148500 [exp] 53 / 3e-10 AT5G16370 760 / 0.0 acyl activating enzyme 5 (.1) Potri.010G141501 [exp] 53 / 3e-10 AT3G16910 123 / 5e-06 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1) Potri.004G000300 [exp] 52 / 9e-10 AT5G16340 756 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.005G099500 [exp] 52 / 1e-09 AT2G17650 800 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.013G096200 [exp] 48 / 3e-08 AT5G16340 779 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.019G068100 [exp] 44 / 6e-07 AT5G16340 778 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016861 pacid=23179071 polypeptide=Lus10016861 locus=Lus10016861.g ID=Lus10016861.BGIv1.0 annot-version=v1.0 ATGGTGAAGTTTTGTAGGGGTAATATGCGTGCTTATTGGGTTCCAAAGTCTGTGGTGTTTGGTCCACTGCCAAAGACTGGTACTGGGAAGATTCAGAAGC ATGTTTTTAGGGGTAAAGGTAAGGAAATGGGAGCAGTTAGGATGAGCAAGATGTAA
AA sequence Show only first row Show all	>Lus10016861 pacid=23179071 polypeptide=Lus10016861 locus=Lus10016861.g ID=Lus10016861.BGIv1.0 annot-version=v1.0 MVKFCRGNMRAYWVPKSVVFGPLPKTGTGKIQKHVFRGKGKEMGAVRMSKM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G16910		AAE7, ACN1	ACETATE NON-UTILIZING 1, acyl-...		Lus10016861 [exp]	0	1
AT3G30210	MYB	ATMYB121	myb domain protein 121 (.1)		Lus10034372 [exp]	1.0	0.9144
AT3G05950			RmlC-like cupins superfamily p...		Lus10041900 [exp]	1.7	0.8200
AT3G51810		AT3, GEA1, ATEM...	GUANINE NUCLEOTIDE EXCHANGE FA...		Lus10027816 [exp]	2.4	0.7650
AT4G22285			Ubiquitin C-terminal hydrolase...		Lus10035547 [exp]	4.5	0.7702
AT1G68460		ATIPT1	Arabidopsis thaliana isopenten...		Lus10034334 [exp]	5.5	0.7664
					Lus10016963 [exp]	6.5	0.7616
AT1G17800		AtENODL22	early nodulin-like protein 22 ...		Lus10020984 [exp]	6.9	0.8263
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10024367 [exp]	7.3	0.7238
AT5G09220		AAP2	amino acid permease 2 (.1)		Lus10027109 [exp]	8.2	0.6925
AT5G18880			RNA-directed DNA polymerase (r...		Lus10018808 [exp]	17.0	0.7361

Compare expression of checked genes

Lus10016861 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.