Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005768 [exp] 124 / 4e-36 AT5G52140 90 / 7e-21 RING/U-box superfamily protein (.1) Lus10002049 [exp] 121 / 5e-36 ND / Lus10010849 [exp] 112 / 3e-33 ND / Lus10015574 [exp] 108 / 3e-31 ND / Lus10013569 [exp] 110 / 7e-31 AT4G35070 125 / 1e-34 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10021853 [exp] 107 / 7e-31 ND / Lus10032492 [exp] 100 / 7e-29 ND / Lus10038559 [exp] 102 / 2e-28 AT2G34585 67 / 1e-14 unknown protein Lus10023022 [exp] 97 / 2e-27 AT3G62770 46 / 7e-07 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016867 pacid=23179074 polypeptide=Lus10016867 locus=Lus10016867.g ID=Lus10016867.BGIv1.0 annot-version=v1.0 ATGGCGACCGGAAGTTCTAGTGCTGATGATGATGTTGAAGAACAATTGAATTGTGACGGGTATTTCGTAAACGGGTTATTTTATGACACTGTCGATGATG CGTGTGATGCGGGTAAGGATATTGCTTTAGACTTAGGATTTCAATTGACTCGTGGATCACATAAGAAGAACCCCAGTAAAGAAGAAAAAGGGTTGTACTT GTATTGCTCGCATGGTGGCAGGGGCAAATCACAGTCTACCACTGCCTCTTCAGAGAGTTCACGTAAGACTACAACATCGTACCCAGGTTGA
AA sequence Show only first row Show all	>Lus10016867 pacid=23179074 polypeptide=Lus10016867 locus=Lus10016867.g ID=Lus10016867.BGIv1.0 annot-version=v1.0 MATGSSSADDDVEEQLNCDGYFVNGLFYDTVDDACDAGKDIALDLGFQLTRGSHKKNPSKEEKGLYLYCSHGGRGKSQSTTASSESSRKTTTSYPG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10016867 [exp]	0	1
AT2G19110		ATHMA4, HMA4	ARABIDOPSIS HEAVY METAL ATPASE...		Lus10006956 [exp]	4.6	1.0000
					Lus10022996 [exp]	5.2	1.0000
					Lus10033373 [exp]	7.1	1.0000
					Lus10014857 [exp]	7.5	1.0000
AT4G16230			GDSL-like Lipase/Acylhydrolase...		Lus10037776 [exp]	10.6	1.0000
AT4G17260			Lactate/malate dehydrogenase f...		Lus10028931 [exp]	11.1	1.0000
AT5G13620			unknown protein		Lus10017168 [exp]	13.2	1.0000
					Lus10026593 [exp]	13.7	1.0000
					Lus10043174 [exp]	13.7	1.0000
AT3G23940			dehydratase family (.1.2)		Lus10043131 [exp]	13.9	1.0000

Compare expression of checked genes

Lus10016867 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.