Lus10016875 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G06700 100 / 2e-30 Ribosomal L29e protein family (.1.2.3)
AT3G06680 99 / 3e-29 Ribosomal L29e protein family (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037740 124 / 1e-39 AT3G06700 100 / 2e-30 Ribosomal L29e protein family (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G142001 105 / 4e-32 AT3G06700 103 / 2e-31 Ribosomal L29e protein family (.1.2.3)
Potri.008G107700 103 / 2e-31 AT3G06700 106 / 2e-32 Ribosomal L29e protein family (.1.2.3)
Potri.002G196800 99 / 1e-29 AT3G06700 96 / 2e-28 Ribosomal L29e protein family (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01779 Ribosomal_L29e Ribosomal L29e protein family
Representative CDS sequence
>Lus10016875 pacid=23179089 polypeptide=Lus10016875 locus=Lus10016875.g ID=Lus10016875.BGIv1.0 annot-version=v1.0
ATGGCCAAGTCGAAGAATCATACCGCTCACAACCAGTCCTACAAGGCTCACAGGAACGGCATCAAGAAGCCTAAGAGCCATCGCCACACCTCCACCAAAG
GGATGGACCCTAAGTTTCTGAGGAACCAGAGGTACGCAAAGAAGCATAACAAGACTGGCGCAGAGGTTGCAAGCGCTGAAGAATAG
AA sequence
>Lus10016875 pacid=23179089 polypeptide=Lus10016875 locus=Lus10016875.g ID=Lus10016875.BGIv1.0 annot-version=v1.0
MAKSKNHTAHNQSYKAHRNGIKKPKSHRHTSTKGMDPKFLRNQRYAKKHNKTGAEVASAEE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G06700 Ribosomal L29e protein family ... Lus10016875 0 1
AT3G06700 Ribosomal L29e protein family ... Lus10037740 1.0 0.9897
AT4G09320 NDPK1 Nucleoside diphosphate kinase ... Lus10003844 2.0 0.9770
AT2G03590 ATUPS1 ureide permease 1 (.1) Lus10037074 5.0 0.9590
AT1G74270 Ribosomal protein L35Ae family... Lus10027754 5.1 0.9500
AT4G14320 Zinc-binding ribosomal protein... Lus10000176 5.5 0.9582
AT2G44120 Ribosomal protein L30/L7 famil... Lus10004220 6.7 0.9639
AT2G20450 Ribosomal protein L14 (.1) Lus10011807 6.9 0.9593
AT5G27700 Ribosomal protein S21e (.1) Lus10031494 7.1 0.9224
AT4G24830 arginosuccinate synthase famil... Lus10012800 7.5 0.9432
AT4G14320 Zinc-binding ribosomal protein... Lus10038130 7.7 0.9540

Lus10016875 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.