Lus10016880 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G16980 159 / 7e-52 NRPE9A, NRPD9A, NRPB9A RNA polymerases M/15 Kd subunit (.1)
AT4G16265 157 / 4e-51 NRPE9B, NRPD9B, NRPB9B RNA polymerases M/15 Kd subunit (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037747 114 / 1e-33 AT3G16980 89 / 1e-23 RNA polymerases M/15 Kd subunit (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G106900 168 / 1e-55 AT3G16980 216 / 1e-74 RNA polymerases M/15 Kd subunit (.1)
Potri.010G142500 101 / 3e-29 AT4G16265 146 / 3e-47 RNA polymerases M/15 Kd subunit (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0167 Zn_Beta_Ribbon PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Representative CDS sequence
>Lus10016880 pacid=23179054 polypeptide=Lus10016880 locus=Lus10016880.g ID=Lus10016880.BGIv1.0 annot-version=v1.0
ATGAGTACCATGAAATTCTGTCGCGAATGTAACAACATCCTTTACCCTAAAGAGGACAGGGATGAAAGGGTTCTTCTCTACGCTTGCCGTAACTGTGATC
ACCAGGAAGTTGCCGAGACATACTGTGTATATAGAAACGAGGTTCATCATTCTGCAGCAGAACGCACTCAGGTGTTGCAGGATGTAGCTGCCGATCCCAC
TCTCCCTCGCACCAAAGATGTTAGATGTGCTGTGTGTAAGCATCCTGAAGCTGTCTTTTTCCAGGAACTAGCAATGACATCATTGCTTGTGCTAGAACAA
GAATTAAGTAAGCGGGCTGGCAAAATCGTCCCCTCAAGTTGA
AA sequence
>Lus10016880 pacid=23179054 polypeptide=Lus10016880 locus=Lus10016880.g ID=Lus10016880.BGIv1.0 annot-version=v1.0
MSTMKFCRECNNILYPKEDRDERVLLYACRNCDHQEVAETYCVYRNEVHHSAAERTQVLQDVAADPTLPRTKDVRCAVCKHPEAVFFQELAMTSLLVLEQ
ELSKRAGKIVPSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G16980 NRPE9A, NRPD9A,... RNA polymerases M/15 Kd subuni... Lus10016880 0 1
AT1G19990 unknown protein Lus10033141 5.3 0.9127
AT3G25150 Nuclear transport factor 2 (NT... Lus10022765 5.9 0.9169
AT4G10630 Glutaredoxin family protein (.... Lus10008270 9.2 0.9014
AT3G49660 AtWDR5a human WDR5 \(WD40 repeat\) hom... Lus10003487 12.5 0.8905
AT2G37020 Translin family protein (.1.2) Lus10020710 15.5 0.8936
AT1G70710 CEL1 ,AtGH9B1 CELLULASE 1, glycosyl hydrolas... Lus10034199 17.3 0.8823
AT5G23860 TUB8, b-TUB tubulin beta 8 (.1.2) Lus10040712 17.7 0.8943
AT2G18510 EMB2444 embryo defective 2444, RNA-bin... Lus10041728 18.9 0.8859
AT5G44500 Small nuclear ribonucleoprotei... Lus10023386 22.6 0.8850
AT2G38730 Cyclophilin-like peptidyl-prol... Lus10026161 23.2 0.8848

Lus10016880 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.