Lus10016909 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037769 117 / 3e-35 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G145700 178 / 3e-55 ND /
Potri.008G105401 69 / 2e-15 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF12617 LdpA_C Iron-Sulfur binding protein C terminal
Representative CDS sequence
>Lus10016909 pacid=23179036 polypeptide=Lus10016909 locus=Lus10016909.g ID=Lus10016909.BGIv1.0 annot-version=v1.0
ATGAGTGGAGATATAGGACGAGGAGCTACAAGGGAATCAGTCGCCTTTGCTGTACGCCTTGCTGCTGCTAAAGACAGACCTCTTGGTTTGTTTCAGTTGG
CTGGTGGCACAAATGCTCACACAGCTGAGGGATTAAAAAGAGAAGGTCTCTTCCAAACAACCTTAGCTACTACTGACGATTCGAAGGATGCGAGATCAAT
TGTGCCTTCTGGCGCCTTCATTGGTGGTGTTGCTTTTGGGGGATACGCCCGGAAGATTGTGGGAAGAGTGCTGAGCTCGATGCCATCACAGCAGGGTCCG
GGCTGGGTCGAGGATTACCCGGAGCTTCTAGCGGAAGCACTTAGACAAGCTCTTGACTTGGTGGGGACAATGAAACTTTACCATCCTGTGCAGGTTCATG
GTTTTGATTCCTGA
AA sequence
>Lus10016909 pacid=23179036 polypeptide=Lus10016909 locus=Lus10016909.g ID=Lus10016909.BGIv1.0 annot-version=v1.0
MSGDIGRGATRESVAFAVRLAAAKDRPLGLFQLAGGTNAHTAEGLKREGLFQTTLATTDDSKDARSIVPSGAFIGGVAFGGYARKIVGRVLSSMPSQQGP
GWVEDYPELLAEALRQALDLVGTMKLYHPVQVHGFDS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10016909 0 1
AT1G73040 Mannose-binding lectin superfa... Lus10037605 5.6 0.8867
AT5G25090 AtENODL13 early nodulin-like protein 13 ... Lus10003432 6.7 0.8254
AT3G15010 RNA-binding (RRM/RBD/RNP motif... Lus10021035 7.2 0.8767
AT5G10530 Concanavalin A-like lectin pro... Lus10007074 12.6 0.8301
Lus10003631 12.7 0.8053
AT5G57910 unknown protein Lus10035808 14.7 0.8032
AT2G42770 Peroxisomal membrane 22 kDa (M... Lus10001421 20.3 0.7885
AT2G01290 RPI2 ribose-5-phosphate isomerase 2... Lus10036094 20.8 0.8264
AT3G57810 Cysteine proteinases superfami... Lus10037002 22.4 0.8170
AT5G06800 GARP myb-like HTH transcriptional r... Lus10023816 22.6 0.8275

Lus10016909 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.