Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G06610 144 / 4e-46 DNA-binding enhancer protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037773 [exp] 206 / 2e-70 AT3G06610 165 / 3e-54 DNA-binding enhancer protein-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G105000 [exp] 165 / 2e-54 AT3G06610 137 / 2e-43 DNA-binding enhancer protein-related (.1) Potri.010G146100 [exp] 165 / 2e-54 AT3G06610 141 / 6e-45 DNA-binding enhancer protein-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016913 pacid=23179060 polypeptide=Lus10016913 locus=Lus10016913.g ID=Lus10016913.BGIv1.0 annot-version=v1.0 ATGGAGGCCGGCGATGAAGGAGTGGAGAGGGTTGAGGACTCCAAGGATATGCAGCAACAGAGCAAGGCCTTCGATAAGCTCACCGACCGAGTCGAGGATC GCCAGCTCGATTCCACCCGCGTCCAAGAGGCTATGGCGTCGATAGCTGCATCTTCCGAAGCTGATTGGAATGCCATGAGATTGAGGGAGAAAGAACTAGC TGCCGTGAAGATCAATCCAGCAGATATTGATGTAATCGCCAACGAATTGGAGTTGGACAAGAAAGTTGCGGAGAGGACGCTGCGGGAGCACAAAGGAGAT GCTGTCGCCGCGATCCGGTACCTTCTGCAGCAGATTAATATTGGGATGAACTAG
AA sequence Show only first row Show all	>Lus10016913 pacid=23179060 polypeptide=Lus10016913 locus=Lus10016913.g ID=Lus10016913.BGIv1.0 annot-version=v1.0 MEAGDEGVERVEDSKDMQQQSKAFDKLTDRVEDRQLDSTRVQEAMASIAASSEADWNAMRLREKELAAVKINPADIDVIANELELDKKVAERTLREHKGD AVAAIRYLLQQINIGMN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G06610			DNA-binding enhancer protein-r...		Lus10016913 [exp]	0	1
AT1G30475			unknown protein		Lus10027131 [exp]	1.4	0.8265
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10032560 [exp]	4.5	0.7965
AT4G25500		ATRSP40, AT-SRP...	ARABIDOPSIS THALIANA ARGININE/...		Lus10038883 [exp]	8.9	0.7210
AT3G62790			NADH-ubiquinone oxidoreductase...		Lus10035034 [exp]	9.2	0.7858
AT3G29280			unknown protein		Lus10018197 [exp]	11.2	0.7476
AT5G11900			Translation initiation factor ...		Lus10024986 [exp]	15.4	0.7745
AT5G47890			NADH-ubiquinone oxidoreductase...		Lus10003023 [exp]	18.3	0.7450
AT5G67490			unknown protein		Lus10000389 [exp]	18.9	0.7379
AT5G44710			unknown protein		Lus10001221 [exp]	25.9	0.6613
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10041513 [exp]	26.3	0.7198

Compare expression of checked genes

Lus10016913 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.