Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31320 48 / 7e-08 SAUR-like auxin-responsive protein family (.1) AT4G34770 47 / 1e-07 SAUR-like auxin-responsive protein family (.1) AT4G34800 44 / 5e-07 SAUR-like auxin-responsive protein family (.1) AT3G43120 44 / 2e-06 SAUR-like auxin-responsive protein family (.1) AT4G34790 43 / 2e-06 SAUR-like auxin-responsive protein family (.1) AT2G24400 44 / 3e-06 SAUR-like auxin-responsive protein family (.1) AT4G34750 43 / 6e-06 SAUR-like auxin-responsive protein family (.1.2) AT1G75590 41 / 3e-05 SAUR-like auxin-responsive protein family (.1) AT4G34780 40 / 3e-05 SAUR-like auxin-responsive protein family (.1) AT4G34810 39 / 5e-05 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016917 [exp] 174 / 3e-58 AT4G34770 48 / 3e-08 SAUR-like auxin-responsive protein family (.1) Lus10035708 [exp] 71 / 3e-17 ND / Lus10026977 [exp] 47 / 2e-07 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1) Lus10008845 [exp] 46 / 3e-07 AT2G46690 102 / 4e-29 SAUR-like auxin-responsive protein family (.1) Lus10032949 [exp] 46 / 4e-07 AT4G00880 104 / 9e-30 SAUR-like auxin-responsive protein family (.1) Lus10033348 [exp] 45 / 2e-06 AT2G24400 155 / 3e-48 SAUR-like auxin-responsive protein family (.1) Lus10034888 [exp] 43 / 7e-06 AT5G20810 210 / 2e-70 SAUR-like auxin-responsive protein family (.1.2) Lus10013808 [exp] 42 / 7e-06 AT2G37030 141 / 1e-44 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 42 / 7e-06 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G278100 [exp] 47 / 2e-07 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.004G164300 [exp] 47 / 2e-07 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1) Potri.013G054600 [exp] 46 / 2e-07 AT4G31320 58 / 1e-11 SAUR-like auxin-responsive protein family (.1) Potri.005G237000 [exp] 44 / 3e-06 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1) Potri.009G127700 [exp] 42 / 3e-06 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.004G165900 [exp] 42 / 3e-06 AT4G34770 99 / 9e-29 SAUR-like auxin-responsive protein family (.1) Potri.010G253800 [exp] 43 / 5e-06 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1) Potri.002G024500 [exp] 43 / 5e-06 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1) Potri.009G125900 [exp] 43 / 5e-06 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1) Potri.012G023400 [exp] 42 / 8e-06 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10016914 pacid=23179108 polypeptide=Lus10016914 locus=Lus10016914.g ID=Lus10016914.BGIv1.0 annot-version=v1.0 ATGGTGTCTTTCTCGTCCAAGTCAGCGCTGAAGAAGAAGAAGGAGCTCGTCACCGGCAGCAGCCACAGACTACCTAAGAAGGGGCACGTCTTCCTGCGCG TCGGAGAGGAGCTAAAGCAATTCGAGATCCCGATCGAGTACCTCAATCACGAAGTACTGAAGCAGCTTTTAACTGAATCGGAGGAGCAGGCCGATCCGCT GGACATCAAGATCGCCGGCGGTCCGTTAGAGATAAGGCCGTGCTCCGTGGAGAGGTTCAGTGCGATTCTGAGCGACATCGAGGATGGCAAGCCATGGAAG CAAGAGATACGGTGGCTGTGGCACTAG
AA sequence Show only first row Show all	>Lus10016914 pacid=23179108 polypeptide=Lus10016914 locus=Lus10016914.g ID=Lus10016914.BGIv1.0 annot-version=v1.0 MVSFSSKSALKKKKELVTGSSHRLPKKGHVFLRVGEELKQFEIPIEYLNHEVLKQLLTESEEQADPLDIKIAGGPLEIRPCSVERFSAILSDIEDGKPWK QEIRWLWH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34770			SAUR-like auxin-responsive pro...		Lus10016914 [exp]	0	1
AT1G71400		AtRLP12	receptor like protein 12 (.1)		Lus10009330 [exp]	5.1	0.5816
AT5G36930			Disease resistance protein (TI...		Lus10007830 [exp]	7.9	0.5712
AT5G63920		TOP3A, AtTOP3al...	topoisomerase 3alpha (.1)		Lus10006779 [exp]	10.8	0.5715
AT5G55930		ATOPT1	ARABIDOPSIS THALIANA OLIGOPEPT...		Lus10004237 [exp]	13.6	0.5666
AT4G33280	B3	REM16	AP2/B3-like transcriptional fa...		Lus10016285 [exp]	16.9	0.5477
AT1G21270		WAK2	wall-associated kinase 2 (.1)		Lus10013385 [exp]	19.7	0.5250
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10021338 [exp]	20.9	0.5327
AT1G27220			paired amphipathic helix repea...		Lus10000805 [exp]	22.6	0.5327
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Lus10030286 [exp]	24.2	0.5327
					Lus10033096 [exp]	25.6	0.5327

Compare expression of checked genes

Lus10016914 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.