Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34770 47 / 5e-08 SAUR-like auxin-responsive protein family (.1) AT4G34800 46 / 2e-07 SAUR-like auxin-responsive protein family (.1) AT3G43120 44 / 3e-06 SAUR-like auxin-responsive protein family (.1) AT2G24400 44 / 4e-06 SAUR-like auxin-responsive protein family (.1) AT4G34790 42 / 5e-06 SAUR-like auxin-responsive protein family (.1) AT4G31320 43 / 6e-06 SAUR-like auxin-responsive protein family (.1) AT1G75590 41 / 2e-05 SAUR-like auxin-responsive protein family (.1) AT4G34810 40 / 2e-05 SAUR-like auxin-responsive protein family (.1) AT4G34780 40 / 3e-05 SAUR-like auxin-responsive protein family (.1) AT4G34750 40 / 4e-05 SAUR-like auxin-responsive protein family (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016914 [exp] 174 / 7e-58 AT4G34770 47 / 5e-08 SAUR-like auxin-responsive protein family (.1) Lus10035708 [exp] 75 / 1e-18 ND / Lus10032949 [exp] 47 / 1e-07 AT4G00880 104 / 9e-30 SAUR-like auxin-responsive protein family (.1) Lus10008845 [exp] 47 / 2e-07 AT2G46690 102 / 4e-29 SAUR-like auxin-responsive protein family (.1) Lus10013808 [exp] 45 / 9e-07 AT2G37030 141 / 1e-44 SAUR-like auxin-responsive protein family (.1) Lus10026521 [exp] 44 / 1e-06 AT2G37030 139 / 8e-44 SAUR-like auxin-responsive protein family (.1) Lus10026977 [exp] 43 / 5e-06 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1) Lus10033348 [exp] 43 / 7e-06 AT2G24400 155 / 3e-48 SAUR-like auxin-responsive protein family (.1) Lus10042376 [exp] 42 / 7e-06 AT4G34770 136 / 3e-43 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G164300 [exp] 47 / 8e-08 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1) Potri.013G054600 [exp] 46 / 2e-07 AT4G31320 58 / 1e-11 SAUR-like auxin-responsive protein family (.1) Potri.004G165900 [exp] 44 / 5e-07 AT4G34770 99 / 9e-29 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 45 / 6e-07 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.010G253800 [exp] 44 / 3e-06 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1) Potri.009G125900 [exp] 43 / 3e-06 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1) Potri.002G024500 [exp] 43 / 5e-06 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1) Potri.012G023400 [exp] 42 / 6e-06 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1) Potri.010G224500 [exp] 42 / 7e-06 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.009G141000 [exp] 42 / 8e-06 AT1G29500 122 / 2e-36 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10016917 pacid=23179125 polypeptide=Lus10016917 locus=Lus10016917.g ID=Lus10016917.BGIv1.0 annot-version=v1.0 ATGGTGTCTTTCTCGTCCAAGTCAGGGCTGAAGAAGAAGGAGAAGCTCGTCACCGACAGCAGCCATAGACTGCCTAAGAAGGGGCACGTCTTCCTGCACG TTGGCGAGGAGCTAAAGCAATTCGAGATCCCGATCGAGTATCTCAATCACGAAGTAATGAAGCAGCTTTTAACTGAATCGGAGGAGTACGCGGATCCGCT GGATATCAAGATCGCCGATGGTCCGTTAGAGATAAGGCCGTGCTCCGTGGAGAGGTTCAGTGCGATTCTGAGCGACATCGAGGAAGGCCACCCATGGAAG GAAGAGATACGGTGGTTGTGGCACTAG
AA sequence Show only first row Show all	>Lus10016917 pacid=23179125 polypeptide=Lus10016917 locus=Lus10016917.g ID=Lus10016917.BGIv1.0 annot-version=v1.0 MVSFSSKSGLKKKEKLVTDSSHRLPKKGHVFLHVGEELKQFEIPIEYLNHEVMKQLLTESEEYADPLDIKIADGPLEIRPCSVERFSAILSDIEEGHPWK EEIRWLWH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34770			SAUR-like auxin-responsive pro...		Lus10016917 [exp]	0	1
AT5G27780			SAUR-like auxin-responsive pro...		Lus10023969 [exp]	3.0	0.9261
AT1G21460		SWEET1, AtSWEET...	Nodulin MtN3 family protein (....		Lus10028634 [exp]	3.2	0.9254
AT1G57790			F-box family protein (.1)		Lus10024904 [exp]	10.8	0.8941
AT1G29430			SAUR-like auxin-responsive pro...		Lus10025115 [exp]	22.1	0.9149
AT5G16023		RTFL18, DVL1	DEVIL 1, ROTUNDIFOLIA like 18 ...		Lus10034071 [exp]	31.7	0.9138
AT2G28610	HD	PRS1, PRS, WOX3	WUSCHEL RELATED HOMEOBOX 3, PR...		Lus10023332 [exp]	35.2	0.8967
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10024627 [exp]	36.5	0.9072
AT5G65230	MYB	ATMYB53	myb domain protein 53 (.1)		Lus10039735 [exp]	37.1	0.8120
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008991 [exp]	40.5	0.8957
AT4G15480		UGT84A1	UDP-Glycosyltransferase superf...		Lus10027862 [exp]	40.8	0.8981

Compare expression of checked genes

Lus10016917 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.