Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23070 57 / 1e-11 Thymidine kinase (.1) AT3G07800 53 / 5e-10 Thymidine kinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012347 [exp] 91 / 2e-24 AT3G07800 303 / 4e-105 Thymidine kinase (.1) Lus10038804 [exp] 62 / 3e-13 AT5G64320 367 / 3e-115 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10039055 [exp] 62 / 5e-13 AT5G23070 309 / 9e-106 Thymidine kinase (.1) Lus10006394 [exp] 49 / 9e-09 AT3G07800 178 / 2e-56 Thymidine kinase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G009951 [exp] 61 / 6e-13 AT3G07800 292 / 7e-100 Thymidine kinase (.1) Potri.002G222300 [exp] 58 / 4e-12 AT3G07800 316 / 2e-110 Thymidine kinase (.1) Potri.006G015800 [exp] 57 / 1e-11 AT5G23070 306 / 8e-105 Thymidine kinase (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016925 pacid=23159613 polypeptide=Lus10016925 locus=Lus10016925.g ID=Lus10016925.BGIv1.0 annot-version=v1.0 ATGTTGAGGAAGACTGAGCAAACTGAGACAGAGCTGATAGCTGGAGCAGCTGTATATATGCCTGTTTGCAGACTGCATTACATCAATGGAGAAGTGGTCA ATGAAGTTACAAAGGGTTTCATTGAATCTTCCGAAACCAGGGTTCATTTATCTTCCAGTTCCTCTAATGGCGAGGCTGTTAAAGCTGTTTAA
AA sequence Show only first row Show all	>Lus10016925 pacid=23159613 polypeptide=Lus10016925 locus=Lus10016925.g ID=Lus10016925.BGIv1.0 annot-version=v1.0 MLRKTEQTETELIAGAAVYMPVCRLHYINGEVVNEVTKGFIESSETRVHLSSSSSNGEAVKAV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G23070			Thymidine kinase (.1)		Lus10016925 [exp]	0	1
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10030175 [exp]	3.5	0.7814
AT4G10440			S-adenosyl-L-methionine-depend...		Lus10008298 [exp]	4.1	0.7132
AT3G10910			RING/U-box superfamily protein...		Lus10033425 [exp]	6.5	0.7430
AT1G69930		ATGSTU11	glutathione S-transferase TAU ...		Lus10026722 [exp]	7.8	0.7854
AT1G65810			P-loop containing nucleoside t...		Lus10035774 [exp]	16.1	0.7275
AT1G13680			PLC-like phosphodiesterases su...		Lus10035130 [exp]	18.7	0.7187
					Lus10009381 [exp]	20.5	0.7150
AT1G70530		CRK3	cysteine-rich RLK (RECEPTOR-li...		Lus10003274 [exp]	24.2	0.6802
AT2G37460			nodulin MtN21 /EamA-like trans...		Lus10024424 [exp]	25.7	0.7525
AT5G66780			unknown protein		Lus10041741 [exp]	29.6	0.6976

Compare expression of checked genes

Lus10016925 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.