Lus10016931 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034743 73 / 4e-18 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10016931 pacid=23159616 polypeptide=Lus10016931 locus=Lus10016931.g ID=Lus10016931.BGIv1.0 annot-version=v1.0
ATGTCCACCCCTGACGCTCCGATCGACCATCTCCCTCCTCTCCTGGCGCCACTCGATGAAGTCGACGAGGCGGCCCCTTCATCAAAAGCCATCTCCTTCT
TTGGTTGGCGTCCCTCGATGAAGCCTCTCCTCCTCCGTAGATTATCGGAAAGCAAGGAAACCTACTCAACACCATGGGCGATTCCGACGTGCCCTCGCAT
CCAGACTCCGGAGGGTGTCGACGAGACTGAAAGAGGGAGGATGGTAGCAGGTATAGGATTCACAGCTCCTGGATCGAGCAGTCGTACTAAGGCTCGGTTT
ACGACAGCGGAGTTGAAGTGTACGATTCCGAGATGGACAGAACGCATGGATGGATGA
AA sequence
>Lus10016931 pacid=23159616 polypeptide=Lus10016931 locus=Lus10016931.g ID=Lus10016931.BGIv1.0 annot-version=v1.0
MSTPDAPIDHLPPLLAPLDEVDEAAPSSKAISFFGWRPSMKPLLLRRLSESKETYSTPWAIPTCPRIQTPEGVDETERGRMVAGIGFTAPGSSSRTKARF
TTAELKCTIPRWTERMDG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10016931 0 1
AT1G28220 ATPUP3 purine permease 3 (.1) Lus10026807 2.4 0.7874
AT4G12500 Bifunctional inhibitor/lipid-t... Lus10032258 3.9 0.7905
AT5G16970 AT-AER alkenal reductase (.1) Lus10035274 11.4 0.8176
Lus10001069 11.5 0.7426
AT5G48850 ATSDI1 SULPHUR DEFICIENCY-INDUCED 1, ... Lus10011872 15.3 0.7840
AT4G10310 ATHKT1, HKT1 high-affinity K+ transporter 1... Lus10030872 15.4 0.7978
AT5G44960 F-box/RNI-like/FBD-like domain... Lus10015246 17.7 0.7737
AT5G64300 ATGCH, ATRIBA1,... RED FLUORESCENT IN DARKNESS 1,... Lus10006669 20.7 0.7823
AT1G19630 CYP722A1 "cytochrome P450, family 722, ... Lus10014285 21.2 0.8090
Lus10026442 21.2 0.7713

Lus10016931 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.