Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034057 [exp] 132 / 8e-42 ND / Lus10023005 [exp] 118 / 9e-36 ND / Lus10023767 [exp] 75 / 1e-17 ND / Lus10007415 [exp] 47 / 3e-07 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016947 pacid=23159619 polypeptide=Lus10016947 locus=Lus10016947.g ID=Lus10016947.BGIv1.0 annot-version=v1.0 ATGGATCTTTCCTATGATCTCAGTGTTGCACCCTCAGAATATGGCGCCTTGACTACGACCATTGCGGATCTCACTCTTGGAAGCAACAAACTCCCATGTA TGTTCCATCTCATCCATTTTTGGCACACAGAGGCTATTCCCATAGGCGAGGTCCCCGCTGCAATTCATACCTTGTGGATCGACCATTCGGTTAGTGCCCC CACCTTTTTCTATTGCAAGTTCATGTCATCATGTAACCATTCCATACTCATTCTTGATCTCCGTTGA
AA sequence Show only first row Show all	>Lus10016947 pacid=23159619 polypeptide=Lus10016947 locus=Lus10016947.g ID=Lus10016947.BGIv1.0 annot-version=v1.0 MDLSYDLSVAPSEYGALTTTIADLTLGSNKLPCMFHLIHFWHTEAIPIGEVPAAIHTLWIDHSVSAPTFFYCKFMSSCNHSILILDLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10016947 [exp]	0	1
					Lus10034057 [exp]	1.0	0.8291
AT1G09790		COBL6	COBRA-like protein 6 precursor...		Lus10016188 [exp]	6.3	0.7294
AT5G08640		ATFLS1, FLS	flavonol synthase 1 (.1.2)		Lus10025619 [exp]	15.4	0.6408
AT4G14660		NRPE7	RNA polymerase Rpb7-like, N-te...		Lus10024251 [exp]	17.0	0.6072
AT1G18790		AtRKD1, RKD1	RWP-RK domain containing 1, RW...		Lus10019100 [exp]	17.8	0.6408
AT1G61680		ATTPS14	terpene synthase 14 (.1.2)		Lus10040632 [exp]	19.9	0.6408
AT2G32300		UCC1	uclacyanin 1 (.1)		Lus10007025 [exp]	21.9	0.6321
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10005010 [exp]	24.2	0.6167
AT5G62300			Ribosomal protein S10p/S20e fa...		Lus10031125 [exp]	27.4	0.5584
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Lus10005050 [exp]	31.9	0.5369

Compare expression of checked genes

Lus10016947 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.