Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016965 [exp] 148 / 5e-47 AT3G11640 69 / 7e-15 unknown protein Lus10021290 [exp] 128 / 1e-39 AT3G11640 61 / 2e-12 unknown protein Lus10000027 [exp] 128 / 6e-39 AT3G11640 63 / 8e-13 unknown protein Lus10029407 [exp] 62 / 8e-13 AT3G52480 74 / 4e-16 unknown protein Lus10004203 [exp] 51 / 8e-09 AT3G52480 77 / 3e-17 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G071700 [exp] 46 / 5e-07 AT3G52480 47 / 3e-06 unknown protein Potri.006G204400 [exp] 46 / 6e-07 AT3G52480 74 / 5e-16 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016964 pacid=23173003 polypeptide=Lus10016964 locus=Lus10016964.g ID=Lus10016964.BGIv1.0 annot-version=v1.0 ATGGAGCTTCTCTATCTATGCTTCTGCGGCAGCTGGAAGAATCACCAGGCCAATCGAATCGAGCCCACCGATGTCACAGTAATTACTTCCGTTGCGGTTG ACGAGGAATTGGAGGAGATGCTGAAGCTCCACCAGCTGTACGGTCTTTCCAGGGCTCTGTTCACGATAAAGGAGGAGTCCGAGAAGGAGGACGACGGAGA TTCCGTAGTGGTGATTCAGGTAGATGACGACGGCGGGGAAGACGGACTGACGCCGCCGTTTACAACGCCGTGTGGTTCTCCTCCGTATTACACTCCGTCG CCGTCTCCTGCTCGTGACTGA
AA sequence Show only first row Show all	>Lus10016964 pacid=23173003 polypeptide=Lus10016964 locus=Lus10016964.g ID=Lus10016964.BGIv1.0 annot-version=v1.0 MELLYLCFCGSWKNHQANRIEPTDVTVITSVAVDEELEEMLKLHQLYGLSRALFTIKEESEKEDDGDSVVVIQVDDDGGEDGLTPPFTTPCGSPPYYTPS PSPARD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11640			unknown protein		Lus10016964 [exp]	0	1
AT3G11640			unknown protein		Lus10016965 [exp]	1.4	0.8975
AT2G33860	ARF	ARF3, ETT	ETTIN, AUXIN RESPONSE TRANSCRI...		Lus10005264 [exp]	1.7	0.9148
AT2G48020			Major facilitator superfamily ...		Lus10008179 [exp]	4.2	0.8958
AT1G65380		AtRLP10, CLV2	clavata 2, Receptor Like Prote...		Lus10026993 [exp]	7.5	0.8864
AT5G12080		ATMSL10, MSL10	mechanosensitive channel of sm...		Lus10019694 [exp]	11.0	0.8468
AT1G65380		AtRLP10, CLV2	clavata 2, Receptor Like Prote...		Lus10020189 [exp]	12.8	0.8805
AT2G42200	SBP	SPL9, AtSPL9	squamosa promoter binding prot...		Lus10012020 [exp]	13.2	0.8692
AT5G41315	bHLH	MYC6.2, GL3	GLABROUS 3, GLABRA 3, basic he...		Lus10032267 [exp]	17.2	0.8514
AT2G42200	SBP	SPL9, AtSPL9	squamosa promoter binding prot...		Lus10016275 [exp]	19.7	0.8622
AT3G47850			unknown protein		Lus10004255 [exp]	20.5	0.7992

Compare expression of checked genes

Lus10016964 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.