Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11620 79 / 2e-19 BAS1 alpha/beta-Hydrolases superfamily protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021300 [exp] 111 / 4e-31 AT3G11620 354 / 2e-122 alpha/beta-Hydrolases superfamily protein (.1.2.3.4) Lus10004214 [exp] 77 / 3e-18 AT3G11620 309 / 4e-105 alpha/beta-Hydrolases superfamily protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G072700 [exp] 89 / 7e-23 AT3G11620 411 / 3e-145 alpha/beta-Hydrolases superfamily protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [flax] [poplar] AB_hydrolase PF10230 [flax] [poplar] LIDHydrolase Lipid-droplet associated hydrolase
Representative CDS sequence Show only first row Show all	>Lus10016975 pacid=23172970 polypeptide=Lus10016975 locus=Lus10016975.g ID=Lus10016975.BGIv1.0 annot-version=v1.0 ATGGGCACTGAGTATTCGGATGCTGAGGTTGTGAAGTCTGCGAATTTTCGGCTGTGCAAGGTTTCGAGTTATACTACAGAACTGCTAGAGATTCAATCAG ATTATCCAACACTGCATGTTCTCTTCGTCCCTGGAAATCCAGGTGCTTGCTTTAAACCTTTCTGTGCTGTTTCATTTTACAAGGATTTTCTGGAGTCGCT TTATGGTTCACTTAGAGGGACTGCTACTATTACAGGCATTTCCTCATCTTAG
AA sequence Show only first row Show all	>Lus10016975 pacid=23172970 polypeptide=Lus10016975 locus=Lus10016975.g ID=Lus10016975.BGIv1.0 annot-version=v1.0 MGTEYSDAEVVKSANFRLCKVSSYTTELLEIQSDYPTLHVLFVPGNPGACFKPFCAVSFYKDFLESLYGSLRGTATITGISSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11620		BAS1	alpha/beta-Hydrolases superfam...		Lus10016975 [exp]	0	1
AT1G22460			O-fucosyltransferase family pr...		Lus10033494 [exp]	2.4	0.7253
AT3G10405			unknown protein		Lus10038692 [exp]	8.7	0.7202
AT1G31480		SGR2	shoot gravitropism 2 (SGR2) (....		Lus10002946 [exp]	11.9	0.7539
AT2G36110			Polynucleotidyl transferase, r...		Lus10029479 [exp]	12.7	0.7067
AT3G29390		RIK	RS2-interacting KH protein (.1...		Lus10032979 [exp]	13.9	0.6903
AT2G43040		NPG1	no pollen germination 1, tetra...		Lus10017638 [exp]	15.6	0.6636
AT3G27670		RST1	RESURRECTION1, ARM repeat supe...		Lus10013074 [exp]	20.2	0.7375
AT5G14850			Alg9-like mannosyltransferase ...		Lus10033341 [exp]	22.2	0.7166
AT4G24470	GATA	GATA25, TIFY1, ...	Zinc-finger protein expressed ...		Lus10042865 [exp]	29.4	0.7169
AT4G37460		SRFR1	SUPPRESSOR OF RPS4-RLD 1, Tetr...		Lus10014863 [exp]	34.1	0.7060

Compare expression of checked genes

Lus10016975 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.