Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01390 111 / 6e-33 AVMA10, VMA10 vacuolar membrane ATPase 10 (.1.2) AT4G23710 89 / 2e-24 VAG2 ,VATG2 ,VHA-G2 vacuolar ATP synthase subunit G2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021301 [exp] 146 / 7e-47 AT4G23710 123 / 1e-37 vacuolar ATP synthase subunit G2 (.1) Lus10029418 [exp] 145 / 2e-46 AT3G01390 143 / 7e-46 vacuolar membrane ATPase 10 (.1.2) Lus10004213 [exp] 145 / 3e-46 AT3G01390 143 / 9e-46 vacuolar membrane ATPase 10 (.1.2) Lus10001543 [exp] 77 / 2e-19 AT4G25950 123 / 8e-38 vacuolar ATP synthase G3 (.1) Lus10009452 [exp] 76 / 3e-19 AT4G25950 123 / 7e-38 vacuolar ATP synthase G3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G040300 [exp] 131 / 5e-41 AT3G01390 145 / 2e-46 vacuolar membrane ATPase 10 (.1.2) Potri.010G222000 [exp] 127 / 1e-39 AT3G01390 147 / 2e-47 vacuolar membrane ATPase 10 (.1.2) Potri.019G080700 [exp] 87 / 3e-23 AT4G25950 120 / 8e-37 vacuolar ATP synthase G3 (.1) Potri.013G108300 [exp] 67 / 1e-15 AT3G01390 64 / 2e-14 vacuolar membrane ATPase 10 (.1.2) Potri.019G133701 [exp] 52 / 6e-10 AT4G25950 74 / 1e-18 vacuolar ATP synthase G3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0255 [flax] [poplar] ATP_synthase PF03179 [flax] [poplar] V-ATPase_G Vacuolar (H+)-ATPase G subunit
Representative CDS sequence Show only first row Show all	>Lus10016977 pacid=23172931 polypeptide=Lus10016977 locus=Lus10016977.g ID=Lus10016977.BGIv1.0 annot-version=v1.0 ATGGAGTCCAGCCGTGGTCAGAATGGTATTCAACTCCTCCTAGCTGCGGAGCAAGAAGCTCAGCAGATTGTCACCACTTCCAGAAATGCAAAAATTGCTA GGTTGAAACAAGCCAAGGACGAGGCTGAGAAGGAAGCTGCTGAATTCCGTGCCCAAATGGAAGCTCAATTTCAGAAAAAGCTAACAGATACCAGTGGGGA CTCGGGGGCTAACGTGAAACGTTTGGAGGAAGAGACAGGGGTAAAGATCGGTGACCTGAAGACTGATGCTGCCAGAATCTCCGTTGAAGTTGTGGACATG CTCCTGAGGCATGTCACCAGCGTTAAAAACTAG
AA sequence Show only first row Show all	>Lus10016977 pacid=23172931 polypeptide=Lus10016977 locus=Lus10016977.g ID=Lus10016977.BGIv1.0 annot-version=v1.0 MESSRGQNGIQLLLAAEQEAQQIVTTSRNAKIARLKQAKDEAEKEAAEFRAQMEAQFQKKLTDTSGDSGANVKRLEEETGVKIGDLKTDAARISVEVVDM LLRHVTSVKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G01390		AVMA10, VMA10	vacuolar membrane ATPase 10 (....		Lus10016977 [exp]	0	1
AT4G23710		VAG2 ,VATG2 ,VH...	vacuolar ATP synthase subunit ...		Lus10021301 [exp]	1.0	0.9107
AT2G30410		TFCA, KIS	TUBULIN FOLDING FACTOR A, tubu...		Lus10031323 [exp]	1.7	0.8592
AT1G77350			unknown protein		Lus10018864 [exp]	2.0	0.8691
AT5G53650			unknown protein		Lus10032946 [exp]	5.5	0.8297
AT2G29960		CYP19-4, ATCYP5...	CYCLOPHILIN 19-4, ARABIDOPSIS ...		Lus10014846 [exp]	5.7	0.8098
AT5G55630		ATTPK1, ATKCO1	TWO PORE K CHANNEL 1, TWO PORE...		Lus10000044 [exp]	6.6	0.7953
AT1G69980			unknown protein		Lus10010734 [exp]	8.0	0.8343
AT1G07960		ATPDIL5-1	PDI-like 5-1 (.1.2.3)		Lus10036125 [exp]	8.9	0.8340
AT2G44360			unknown protein		Lus10012711 [exp]	10.5	0.8049
AT1G69980			unknown protein		Lus10036679 [exp]	11.8	0.8119

Compare expression of checked genes

Lus10016977 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.