Lus10016980 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G22250 332 / 7e-114 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44260 320 / 8e-109 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G10960 273 / 1e-90 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT2G32070 264 / 6e-87 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 263 / 2e-86 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT1G15920 250 / 3e-81 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT1G61470 131 / 1e-35 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G06450 132 / 2e-35 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 119 / 1e-30 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27890 109 / 2e-27 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021304 565 / 0 AT5G22250 335 / 8e-116 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10004212 459 / 1e-163 AT3G44260 336 / 1e-116 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10034180 343 / 7e-118 AT5G22250 410 / 4e-146 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10018330 275 / 4e-91 AT2G32070 444 / 3e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017123 271 / 7e-90 AT2G32070 447 / 1e-160 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10003635 268 / 1e-88 AT2G32070 435 / 6e-156 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10036291 267 / 4e-88 AT2G32070 432 / 9e-155 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029417 227 / 1e-74 AT5G22250 164 / 2e-51 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000327 147 / 3e-41 AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G205600 383 / 2e-133 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G073000 367 / 2e-127 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 346 / 3e-119 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 338 / 4e-116 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G046700 274 / 6e-91 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 269 / 6e-89 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.006G262500 265 / 3e-87 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G020900 264 / 4e-87 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 263 / 9e-87 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G040400 258 / 5e-85 AT5G22250 253 / 4e-84 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10016980 pacid=23173006 polypeptide=Lus10016980 locus=Lus10016980.g ID=Lus10016980.BGIv1.0 annot-version=v1.0
ATGAACAATATCCCCACGTTTGTTGCCTTCTCCTTTTCCGTTACCCTTTTCCTATATAACTCCGTCGTCTGCCATGTTCCTCCGCCTCCTCCGCCTCTCT
GGGCTGTTCGTTTCCATCGCCAACGAAGTCACCTCGGATCTTCGCCGCCTCTTCGTCCATCTCTGGATGCGCTCTGTTTTCAGACCGATCCTCCTCTCCC
CCAACAATCAGCCATGTCTAAATCCACCGGCGAAGAGTCGATCGCCTCCCTGCCGCCGCCTCTTCCTTCTTCGCCCTGCCGACCTGTCGTGATCCGATCG
GTGTGGGCGGAGAATCTCGTATCGGAGTTCTTGGTAATCCGGAAAGTCGTAGAAAAGTACCCGCTGATTTCCATGGACACGGAGTTCCCAGGCGTTGTGA
TTCGCGCGCAGGGCGTCGAACAAAGTCATCGATCGCAGGATCCAACGGGAAGGTATGCGATCCTCAAGGCCAACGTTGATGCGCTTAAACTGATCCAGGT
AGGGCTCACGCTCGCCAATAAGGAAGGGAATTTGCCGGATTTTGGAACTGGGAGTTGTTATATATGGGAATTCAATTTTAGGGATTTTGATGTGTCTTGC
GACTATCATGCTCATGACTCCGTTGACATGTTGAGGAGGCAAGGGATGGATTTCGAGAAAAACAGAAAGGAAGGAGTTGAGGCTGTGAAATTTGCCGAGC
TGATGATGTCGTCGGGACTGGTGTTGGATCCCTCAGTTAGTTGGGTCACATTTCATAGCGCTTATGATTTTGGTTACTTGGTGAAGTGTTTGACTCAGAA
GCCTTTGCCCGATGGCTTGACTGAGTTTCTTGATTTGGTGAGAATGTTCTTTGGGGACAACGTTTATGACGTTAAGCATTTCATGAAGTTTGGGGCGAAC
TTGTTTGGTGGTCTTGATAGGACATGCAAGACTTTGGGTGTGGAGCGGGTCACTGGGAAGAGTCACCAAGCTGGTTCAGATAGCTTGGCGACACTCCACG
CCTTTCAGAAAATGAGAGAGAAGTACTTCAATGGTAGGGAGGATGGAGCAATAGAAAAGTACGCAAATGTTTTATATGGATTAGAGCTGCTAACTTCATA
G
AA sequence
>Lus10016980 pacid=23173006 polypeptide=Lus10016980 locus=Lus10016980.g ID=Lus10016980.BGIv1.0 annot-version=v1.0
MNNIPTFVAFSFSVTLFLYNSVVCHVPPPPPPLWAVRFHRQRSHLGSSPPLRPSLDALCFQTDPPLPQQSAMSKSTGEESIASLPPPLPSSPCRPVVIRS
VWAENLVSEFLVIRKVVEKYPLISMDTEFPGVVIRAQGVEQSHRSQDPTGRYAILKANVDALKLIQVGLTLANKEGNLPDFGTGSCYIWEFNFRDFDVSC
DYHAHDSVDMLRRQGMDFEKNRKEGVEAVKFAELMMSSGLVLDPSVSWVTFHSAYDFGYLVKCLTQKPLPDGLTEFLDLVRMFFGDNVYDVKHFMKFGAN
LFGGLDRTCKTLGVERVTGKSHQAGSDSLATLHAFQKMREKYFNGREDGAIEKYANVLYGLELLTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G22250 AtCAF1b CCR4- associated factor 1b, Po... Lus10016980 0 1
AT4G03000 RING/U-box superfamily protein... Lus10021953 3.0 0.8225
AT4G03000 RING/U-box superfamily protein... Lus10041245 3.7 0.8318
AT1G66340 AtETR1, EIN1, E... ETHYLENE RESPONSE 1, ETHYLENE ... Lus10020778 6.5 0.7957
AT4G25672 CPuORF12 conserved peptide upstream ope... Lus10027512 9.3 0.8316
AT1G77590 LACS9 long chain acyl-CoA synthetase... Lus10018178 9.8 0.8169
AT3G09030 BTB/POZ domain-containing prot... Lus10004834 11.0 0.7863
AT2G16770 bZIP bZIP23 Basic-leucine zipper (bZIP) tr... Lus10014121 11.1 0.7350
AT2G31820 Ankyrin repeat family protein ... Lus10027074 14.1 0.7968
AT5G18400 Cytokine-induced anti-apoptosi... Lus10010213 14.3 0.7852
AT3G27320 alpha/beta-Hydrolases superfam... Lus10037056 17.6 0.7866

Lus10016980 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.