Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G05220 139 / 4e-44 Ribosomal S17 family protein (.1.2) AT2G04390 139 / 5e-44 Ribosomal S17 family protein (.1) AT3G10610 139 / 5e-44 Ribosomal S17 family protein (.1) AT5G04800 139 / 8e-44 Ribosomal S17 family protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021307 [exp] 159 / 1e-51 AT5G04800 231 / 9e-80 Ribosomal S17 family protein (.1.2.3.4) Lus10004208 [exp] 152 / 8e-49 AT2G04390 233 / 4e-80 Ribosomal S17 family protein (.1) Lus10029412 [exp] 152 / 8e-49 AT2G04390 233 / 4e-80 Ribosomal S17 family protein (.1) Lus10041076 [exp] 141 / 1e-44 AT5G04800 226 / 8e-78 Ribosomal S17 family protein (.1.2.3.4) Lus10030344 [exp] 141 / 6e-41 AT1G80560 655 / 0.0 ARABIDOPSIS ISOPROPYLMALATE DEHYDROGENASE 2, isopropylmalate dehydrogenase 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G017300 [exp] 141 / 1e-44 AT5G04800 229 / 1e-78 Ribosomal S17 family protein (.1.2.3.4) Potri.010G241200 [exp] 140 / 2e-44 AT5G04800 228 / 2e-78 Ribosomal S17 family protein (.1.2.3.4) Potri.016G073750 [exp] 90 / 1e-24 AT5G04800 171 / 5e-56 Ribosomal S17 family protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00833 [flax] [poplar] Ribosomal_S17e Ribosomal S17
Representative CDS sequence Show only first row Show all	>Lus10016985 pacid=23172982 polypeptide=Lus10016985 locus=Lus10016985.g ID=Lus10016985.BGIv1.0 annot-version=v1.0 ATGGGTCGCGTTCGTACCAAGACCGTGAAGAAATCCTCCCGCCAGGTCATCGAGCGTTACTACTCGAAGATGACTCTCGACTTCCACACCAACAAGAAGA TCCTTGAGGAAGTGGCAATCATCCCTTCCAAGCGCCTCCGCAACAAGATCGCCGGATTCTCCACTCACCTGATGAAGCGTATCCAGAAGGGCCCAGTCCG TGGCATGGCCGACTGTCCTGGAATCGTTGAGGTCGATCCTGTTGCCGTCAGCGCTCCGCAGTTCGGCTTTGGAAGGGGTGCTGGTCGTGGGAGGTACTGA
AA sequence Show only first row Show all	>Lus10016985 pacid=23172982 polypeptide=Lus10016985 locus=Lus10016985.g ID=Lus10016985.BGIv1.0 annot-version=v1.0 MGRVRTKTVKKSSRQVIERYYSKMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGMADCPGIVEVDPVAVSAPQFGFGRGAGRGRY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G10610			Ribosomal S17 family protein (...		Lus10016985 [exp]	0	1
AT5G59970			Histone superfamily protein (....		Lus10041919 [exp]	5.9	0.9174
AT3G53430			Ribosomal protein L11 family p...		Lus10015086 [exp]	7.7	0.8870
AT2G03530		ATUPS2, UPS2	ARABIDOPSIS THALIANA UREIDE PE...		Lus10036911 [exp]	8.1	0.8992
AT1G26740			Ribosomal L32p protein family ...		Lus10008442 [exp]	9.2	0.8848
AT4G08280			Thioredoxin superfamily protei...		Lus10003739 [exp]	13.2	0.8350
AT5G28640		ATGIF1, GIF1, A...	ARABIDOPSIS GRF1-INTERACTING F...		Lus10006568 [exp]	13.7	0.9037
AT1G49410		TOM6	translocase of the outer mitoc...		Lus10007383 [exp]	13.7	0.9147
AT3G55280		RPL23A2, RPL23A...	RIBOSOMAL PROTEIN L23A2, ribos...		Lus10003290 [exp]	17.2	0.8775
AT5G41685			Mitochondrial outer membrane t...		Lus10007843 [exp]	20.0	0.9129
AT3G03920			H/ACA ribonucleoprotein comple...		Lus10020289 [exp]	20.1	0.8727

Compare expression of checked genes

Lus10016985 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.