Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11591 44 / 1e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024722 [exp] 56 / 3e-12 AT3G11591 74 / 1e-19 unknown protein Lus10032336 [exp] 54 / 9e-12 AT3G11591 77 / 1e-20 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G011620 [exp] 76 / 2e-20 AT3G11591 44 / 6e-08 unknown protein Potri.006G207600 [exp] 53 / 2e-11 AT3G11591 89 / 1e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016986 pacid=23173011 polypeptide=Lus10016986 locus=Lus10016986.g ID=Lus10016986.BGIv1.0 annot-version=v1.0 ATGGTGGGGTGCTTTCCTTCGTCGCCGAAGAAATTGGCTATGACAGCGGCCCTGTTTGCAGGATCAGCCGCGATCATGGGTTACGCGGTGCACCTCTCCT ATCTGAATGTTGCTCCTCAACGAGAACGTACTATAGCTCGGGACGAGTTCGTCAAGGAAAGGATGAGACAGAGGCATGGCTATGGGAAATAG
AA sequence Show only first row Show all	>Lus10016986 pacid=23173011 polypeptide=Lus10016986 locus=Lus10016986.g ID=Lus10016986.BGIv1.0 annot-version=v1.0 MVGCFPSSPKKLAMTAALFAGSAAIMGYAVHLSYLNVAPQRERTIARDEFVKERMRQRHGYGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11591			unknown protein		Lus10016986 [exp]	0	1
AT3G61113			Ubiquitin related modifier 1 (...		Lus10036551 [exp]	2.8	0.8740
AT5G46030			unknown protein		Lus10025438 [exp]	2.8	0.8621
AT4G21192			Cytochrome c oxidase biogenesi...		Lus10019246 [exp]	4.2	0.8589
AT1G71430			unknown protein		Lus10007091 [exp]	4.5	0.8419
AT3G07525		ATG10, ATATG10	autophagy 10, autophagocytosis...		Lus10008745 [exp]	5.7	0.7949
AT5G61970			signal recognition particle-re...		Lus10040614 [exp]	6.2	0.8242
AT5G55140			ribosomal protein L30 family p...		Lus10031912 [exp]	6.3	0.8510
AT5G63060			Sec14p-like phosphatidylinosit...		Lus10039952 [exp]	6.9	0.8167
					Lus10002080 [exp]	7.6	0.7997
AT1G67620			Lojap-related protein (.1)		Lus10036979 [exp]	7.9	0.8299

Compare expression of checked genes

Lus10016986 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.