Lus10017003 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G06240 180 / 9e-59 EMB2735 embryo defective 2735 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021327 283 / 2e-99 AT5G06240 210 / 1e-70 embryo defective 2735 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G074700 215 / 1e-72 AT5G06240 215 / 2e-72 embryo defective 2735 (.1)
Potri.006G208200 58 / 8e-12 AT5G06240 67 / 2e-15 embryo defective 2735 (.1)
PFAM info
Representative CDS sequence
>Lus10017003 pacid=23173007 polypeptide=Lus10017003 locus=Lus10017003.g ID=Lus10017003.BGIv1.0 annot-version=v1.0
ATGAAGACGAAAGTGGTGAGCCGCAAACTGTATGATTACGTCCGCTACGACTTGAAAGAAATTGCGTTCCCGTCCTCTCTCCCCAACCCTCCTCACATCA
AACCACGTCCCGAATTGACCTTCTACGATCGTTTCCTTATTCTGAAGAAGGCGACGAGGCTTTATTGTGCGAGCTGGGTGAGGGATATAGGTCCCGACCT
TCGCCCAAATGATTACAAGAAGCGGAAAGAGAGCGAAGATAACCCAGATGGAACAAATTCTGGAGTGAAGGAGCCATCAGTGCTTGAAGATCTTGCGGTG
GCTGCAAGAGGTGGCGCCGACACCTTGAAACCAGCCTTGCAGAGGTTGTACATGACCAGAGCTTCTGCATACCGAGATGCTCTGAAAAGTTTCATAGAAG
GGTATCAGGAAGGTGTCCAGCAGGTTGTGGAGAAGAAGCAAGAATCTGAAACTGGACATGAGGGAGACACTCCTAAGAAATCATTATGA
AA sequence
>Lus10017003 pacid=23173007 polypeptide=Lus10017003 locus=Lus10017003.g ID=Lus10017003.BGIv1.0 annot-version=v1.0
MKTKVVSRKLYDYVRYDLKEIAFPSSLPNPPHIKPRPELTFYDRFLILKKATRLYCASWVRDIGPDLRPNDYKKRKESEDNPDGTNSGVKEPSVLEDLAV
AARGGADTLKPALQRLYMTRASAYRDALKSFIEGYQEGVQQVVEKKQESETGHEGDTPKKSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G06240 EMB2735 embryo defective 2735 (.1) Lus10017003 0 1
AT5G53070 Ribosomal protein L9/RNase H1 ... Lus10005909 9.3 0.8511
AT1G02170 AtMCP1b, ATMC1,... LSD ONE LIKE 3, ARABIDOPSIS TH... Lus10010764 10.9 0.8543
AT4G19540 INDH, INDL IND1(iron-sulfur protein requi... Lus10018779 16.2 0.8539
AT3G14460 LRR and NB-ARC domains-contain... Lus10039548 20.8 0.8436
AT5G63030 GRXC1 glutaredoxin C1, Thioredoxin s... Lus10001237 25.7 0.8493
Lus10029247 37.9 0.7990
AT1G04530 TPR4 tetratricopeptide repeat 4, Te... Lus10000257 42.7 0.8313
AT5G05830 RING/FYVE/PHD zinc finger supe... Lus10029242 55.2 0.8266
AT1G79230 STR1, ATRDH1, A... ARABIDOPSIS THALIANA RHODANESE... Lus10031753 60.8 0.8100
Lus10034710 69.4 0.8270

Lus10017003 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.