Lus10017013 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47960 112 / 4e-31 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
AT3G17140 69 / 2e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G64620 42 / 7e-05 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
AT1G56100 39 / 0.0007 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1.2.3)
AT5G46940 39 / 0.0007 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016318 219 / 1e-73 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017040 191 / 1e-62 AT1G47960 92 / 3e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10027947 123 / 9e-36 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10000822 123 / 9e-36 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016317 122 / 4e-35 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10037792 117 / 2e-33 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017076 111 / 3e-31 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10021338 97 / 2e-26 AT1G47960 59 / 3e-12 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017014 83 / 3e-21 AT1G47960 56 / 4e-11 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G063000 115 / 6e-33 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.009G083500 84 / 2e-20 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.008G102600 66 / 8e-14 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.006G134900 58 / 1e-10 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.001G288500 56 / 2e-10 AT1G47960 59 / 1e-11 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.007G108301 51 / 4e-08 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.010G209800 47 / 1e-06 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.001G127500 44 / 9e-06 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.013G012800 42 / 3e-05 ND /
Potri.001G109700 39 / 0.0006 AT1G47960 46 / 2e-06 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10017013 pacid=23172948 polypeptide=Lus10017013 locus=Lus10017013.g ID=Lus10017013.BGIv1.0 annot-version=v1.0
ATGGCAACAGTATTGCCGACTAAACTCGCTACCCTCGCCTCTGTTTTCCTTGTGGTGGTCCTCCTGTCCCATAACATGATATCACCAACAAGAGCAGACA
AGGATCTGATCCTGAGAACTTGTAAGAATACCCAATTCTTCAATGTTTGCGTCTCGGCGTTGCTTGAAGACTCTCGTGGACTCAAGGCCAACGACGTGAC
TTCGCTGGCTTTGATATTGATCGACGTCGTACAGGCAAAAGGGATGGTGGTCTACAAGGAGATAAAGCAATTGCAGATGACCAACCCAGAACTGAAGAAG
CCGCTCCAGGATTGTGCTGATGATTACCATATAGTGCTTCACGAGGATCATGACGTGGCAGTGGAAGCGGTGAGTAAAGGGGATCCCAAATTTGGAGAGG
ACGCAATGAGTGACGCTCGAGGTGAGGCACAAAACTGCGAGGGTTCGTTCAAAAACTATGATAAAAAATCCCCCTTAACCCAACTCAACTATGATGTATA
TGAGATCGCCAGCGTAACCTGGGCCGTTATCCGAACGCTCGAATGA
AA sequence
>Lus10017013 pacid=23172948 polypeptide=Lus10017013 locus=Lus10017013.g ID=Lus10017013.BGIv1.0 annot-version=v1.0
MATVLPTKLATLASVFLVVVLLSHNMISPTRADKDLILRTCKNTQFFNVCVSALLEDSRGLKANDVTSLALILIDVVQAKGMVVYKEIKQLQMTNPELKK
PLQDCADDYHIVLHEDHDVAVEAVSKGDPKFGEDAMSDARGEAQNCEGSFKNYDKKSPLTQLNYDVYEIASVTWAVIRTLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10017013 0 1
AT5G53420 CCT motif family protein (.1.2... Lus10019027 7.2 0.8873
AT3G21360 2-oxoglutarate (2OG) and Fe(II... Lus10025819 11.1 0.8822
AT5G25190 AP2_ERF ESE3 ethylene and salt inducible 3,... Lus10016815 13.0 0.8754
AT4G24910 Protein of unknown function (D... Lus10002345 16.0 0.8841
AT3G63440 ATCKX6, CKX6, A... CYTOKININ OXIDASE 6, cytokinin... Lus10005317 18.4 0.8692
AT1G53920 GLIP5 GDSL-motif lipase 5 (.1) Lus10013185 19.3 0.8580
Lus10011339 22.0 0.8566
AT4G24910 Protein of unknown function (D... Lus10003160 25.0 0.8763
AT1G18590 SOT17, ATSOT17,... ARABIDOPSIS SULFOTRANSFERASE 5... Lus10017878 25.5 0.8541
AT2G04480 unknown protein Lus10032584 25.6 0.8727

Lus10017013 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.