Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47960 40 / 3e-05 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021338 [exp] 79 / 3e-21 AT1G47960 59 / 3e-12 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017013 [exp] 62 / 2e-13 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016318 [exp] 61 / 2e-13 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017040 [exp] 48 / 3e-08 AT1G47960 92 / 3e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016317 [exp] 41 / 7e-06 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017014 pacid=23172945 polypeptide=Lus10017014 locus=Lus10017014.g ID=Lus10017014.BGIv1.0 annot-version=v1.0 ATGGTGATTTTGAACGAGATAAAGAAATTGCAGGCAACCAACCCTGAACTAAAGAAGCCACTCCAAAAATGCGCTCAGGGTTACGATGATGTGGTCCACA GTGATCACGATGAGGTCGTGGACGCTGTGAGTGGTGGGGTCTCCAAATTTGGAGAGGATGCTATTAGTGACTCTCAAGCTGAGCCACAAGATTGA
AA sequence Show only first row Show all	>Lus10017014 pacid=23172945 polypeptide=Lus10017014 locus=Lus10017014.g ID=Lus10017014.BGIv1.0 annot-version=v1.0 MVILNEIKKLQATNPELKKPLQKCAQGYDDVVHSDHDEVVDAVSGGVSKFGEDAISDSQAEPQD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10017014 [exp]	0	1
AT3G62890			Pentatricopeptide repeat (PPR)...		Lus10033544 [exp]	1.7	0.9355
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10013922 [exp]	2.0	0.9440
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10013921 [exp]	3.7	0.9403
AT2G43590			Chitinase family protein (.1)		Lus10032794 [exp]	6.0	0.9012
AT3G19170		ATPREP1, ATZNMP	presequence protease 1 (.1.2)		Lus10027907 [exp]	6.8	0.8925
AT5G54740		SESA5	seed storage albumin 5 (.1)		Lus10023514 [exp]	7.5	0.9058
AT4G16260			Glycosyl hydrolase superfamily...		Lus10016883 [exp]	14.3	0.9071
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020493 [exp]	15.9	0.9105
AT5G51890			Peroxidase superfamily protein...		Lus10038054 [exp]	19.6	0.9060
AT5G19890			Peroxidase superfamily protein...		Lus10026748 [exp]	20.6	0.8958

Compare expression of checked genes

Lus10017014 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.