Lus10017018 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36210 119 / 1e-35 SAUR-like auxin-responsive protein family (.1)
AT4G09530 68 / 8e-16 SAUR-like auxin-responsive protein family (.1)
AT3G43120 66 / 2e-14 SAUR-like auxin-responsive protein family (.1)
AT4G34780 61 / 7e-13 SAUR-like auxin-responsive protein family (.1)
AT5G20810 61 / 2e-12 SAUR-like auxin-responsive protein family (.1.2)
AT3G53250 59 / 2e-12 SAUR-like auxin-responsive protein family (.1)
AT5G66260 59 / 3e-12 SAUR-like auxin-responsive protein family (.1)
AT3G51200 58 / 7e-12 SAUR-like auxin-responsive protein family (.1)
AT4G34760 58 / 8e-12 SAUR-like auxin-responsive protein family (.1)
AT1G16510 58 / 1e-11 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021341 241 / 2e-83 AT2G36210 123 / 4e-37 SAUR-like auxin-responsive protein family (.1)
Lus10034888 61 / 3e-12 AT5G20810 210 / 2e-70 SAUR-like auxin-responsive protein family (.1.2)
Lus10031754 60 / 4e-12 AT3G12830 170 / 2e-55 SAUR-like auxin-responsive protein family (.1)
Lus10026977 60 / 1e-11 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1)
Lus10031178 59 / 1e-11 AT1G56150 128 / 1e-38 SAUR-like auxin-responsive protein family (.1)
Lus10012189 57 / 1e-11 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1)
Lus10007553 57 / 2e-11 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1)
Lus10012185 56 / 4e-11 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1)
Lus10007560 56 / 6e-11 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G211000 158 / 5e-51 AT2G36210 130 / 3e-40 SAUR-like auxin-responsive protein family (.1)
Potri.001G060400 68 / 1e-14 AT5G50760 71 / 5e-15 SAUR-like auxin-responsive protein family (.1)
Potri.003G167400 67 / 1e-14 AT5G50760 100 / 4e-27 SAUR-like auxin-responsive protein family (.1)
Potri.006G278100 64 / 1e-13 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.008G037900 62 / 3e-13 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.009G126000 59 / 3e-12 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1)
Potri.006G137200 61 / 4e-12 AT5G20810 201 / 1e-66 SAUR-like auxin-responsive protein family (.1.2)
Potri.004G164400 59 / 4e-12 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1)
Potri.018G063400 60 / 6e-12 AT5G20810 219 / 3e-74 SAUR-like auxin-responsive protein family (.1.2)
Potri.013G111000 56 / 2e-11 AT4G09530 93 / 3e-26 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10017018 pacid=23172962 polypeptide=Lus10017018 locus=Lus10017018.g ID=Lus10017018.BGIv1.0 annot-version=v1.0
ATGCTAGGAGAAAAGATGGTGTCTTTCAGGAAACTGGCGAGGAAAGTCAAGGTAATAACCCGGAGCAGCAGCAGCAGCAGCAATTACTTCGACCAATACG
ACATGTCGTCGCCGCATCTGGAGTGCCTGCTGGTGGAGGATAATGATCAGGAGTCGGGAGCTGCGACGCCGATGGGGTACTTCGCGGTGTACGTAGGGGA
AGATAAAGAGAGGTATGTGGTCCCCACTGGGTTCCTGTCTCACCCTTTGTTCAAGATGTTGATGGAGAAAGCTTACAGCGACCAGCAGAGGGACAGGCTG
GTCATTCCCTGCAGCGTGTCTACGTTCCAGGAGGTCGTGAATGCTGTCCAGTGCTGTAATGGGAGGTTTGATCTCGGGAATTTGGTGGAGGAGTTGTTGT
AG
AA sequence
>Lus10017018 pacid=23172962 polypeptide=Lus10017018 locus=Lus10017018.g ID=Lus10017018.BGIv1.0 annot-version=v1.0
MLGEKMVSFRKLARKVKVITRSSSSSSNYFDQYDMSSPHLECLLVEDNDQESGAATPMGYFAVYVGEDKERYVVPTGFLSHPLFKMLMEKAYSDQQRDRL
VIPCSVSTFQEVVNAVQCCNGRFDLGNLVEELL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36210 SAUR-like auxin-responsive pro... Lus10017018 0 1
AT5G14230 unknown protein Lus10015811 6.5 0.7495
AT4G22780 ACR7 ACT domain repeat 7 (.1) Lus10006662 8.4 0.8174
AT3G05320 O-fucosyltransferase family pr... Lus10040618 13.7 0.7550
Lus10039878 17.9 0.7715
AT4G24570 DIC2 dicarboxylate carrier 2 (.1) Lus10015570 22.9 0.7971
AT2G25270 unknown protein Lus10038102 28.1 0.7869
AT1G70140 ATFH8 formin 8 (.1) Lus10042154 29.4 0.7269
AT5G17350 unknown protein Lus10035268 35.2 0.7540
AT5G43400 Uncharacterised conserved prot... Lus10013399 35.7 0.7375
AT5G42660 Protein of unknown function (D... Lus10024684 35.9 0.7587

Lus10017018 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.