Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20160 215 / 1e-73 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3) AT4G22380 214 / 2e-73 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) AT4G12600 211 / 6e-72 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) AT5G08180 67 / 1e-14 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015295 [exp] 224 / 6e-75 AT4G22380 217 / 7e-72 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10043276 [exp] 213 / 1e-69 AT5G55190 428 / 9e-153 RAN GTPase 3 (.1) Lus10025435 [exp] 211 / 2e-69 AT4G22380 203 / 7e-66 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10019420 [exp] 211 / 4e-69 AT5G55190 443 / 8e-159 RAN GTPase 3 (.1) Lus10010993 [exp] 57 / 4e-11 AT5G08180 229 / 3e-78 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Lus10000421 [exp] 57 / 5e-11 AT5G08180 240 / 9e-83 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Lus10040161 [exp] 56 / 2e-10 AT5G08180 226 / 4e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Lus10004366 [exp] 56 / 2e-10 AT5G08180 227 / 1e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G116800 [exp] 220 / 2e-75 AT4G12600 216 / 3e-74 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Potri.019G087100 [exp] 216 / 5e-74 AT4G12600 213 / 9e-73 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Potri.008G110100 [exp] 57 / 4e-11 AT5G08180 225 / 8e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0101 [flax] [poplar] PELOTA PF01248 [flax] [poplar] Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence Show only first row Show all	>Lus10017031 pacid=23173012 polypeptide=Lus10017031 locus=Lus10017031.g ID=Lus10017031.BGIv1.0 annot-version=v1.0 ATGGTGCAGAGTGGTGAAGCAGTAAACCCGAAAGCATACCCTCTCGCTGATTCTCAGCTGACAATCACCATTCTCGATCTTGTTCAACAAGCTGCTAACT ACAAGCAGCTCAAGAAGGGAGCGAATGAAGCTACCAAGACATTGAACAGGGGTATCTCTGAGTTCGTTGTCATGGCTGCCGATACTGAGCCGCTCGAGAT TCTTCTCCACCTTCCATTGCTTGCTGAGGACAAGAATGTGCCATATGTGTTTGTTCCGTCAAAGCAAGCACTTGGCAGAGCTTGCGGGGTCACAAGACCT GTGATCTCTTGTTCCGTGACAACGAACGAAGGAAGTCAATTGAAGTCTCAGATACAACAACTCAAGGACGCCATTGAAAAGCTGTTGATCTAA
AA sequence Show only first row Show all	>Lus10017031 pacid=23173012 polypeptide=Lus10017031 locus=Lus10017031.g ID=Lus10017031.BGIv1.0 annot-version=v1.0 MVQSGEAVNPKAYPLADSQLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFVVMAADTEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRP VISCSVTTNEGSQLKSQIQQLKDAIEKLLI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G22380			Ribosomal protein L7Ae/L30e/S1...		Lus10017031 [exp]	0	1
AT3G05560			Ribosomal L22e protein family ...		Lus10006509 [exp]	1.7	0.9049
AT5G10360		RPS6B, EMB3010	Ribosomal protein small subuni...		Lus10007376 [exp]	2.0	0.8988
AT3G05560			Ribosomal L22e protein family ...		Lus10037498 [exp]	3.5	0.8636
AT1G41880			Ribosomal protein L35Ae family...		Lus10040235 [exp]	4.2	0.8783
AT5G06360			Ribosomal protein S8e family p...		Lus10021274 [exp]	5.5	0.8520
AT5G23740		RPS11-BETA	ribosomal protein S11-beta (.1...		Lus10005348 [exp]	6.7	0.8630
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10043405 [exp]	6.9	0.8407
AT3G11510			Ribosomal protein S11 family p...		Lus10014220 [exp]	11.2	0.8421
AT3G22660			rRNA processing protein-relate...		Lus10031120 [exp]	11.6	0.8371
AT2G19740			Ribosomal protein L31e family ...		Lus10018032 [exp]	13.0	0.8346

Compare expression of checked genes

Lus10017031 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.