Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74350 167 / 2e-49 Intron maturase, type II family protein (.1) AT5G04050 47 / 3e-07 RNA-directed DNA polymerase (reverse transcriptase) (.1), RNA-directed DNA polymerase (reverse transcriptase) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021359 [exp] 227 / 4e-71 AT1G74350 838 / 0.0 Intron maturase, type II family protein (.1) Lus10038971 [exp] 42 / 4e-05 AT5G04050 704 / 0.0 RNA-directed DNA polymerase (reverse transcriptase) (.1), RNA-directed DNA polymerase (reverse transcriptase) (.2) Lus10027263 [exp] 40 / 9e-05 AT5G04050 690 / 0.0 RNA-directed DNA polymerase (reverse transcriptase) (.1), RNA-directed DNA polymerase (reverse transcriptase) (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G063750 [exp] 179 / 9e-54 AT1G74350 877 / 0.0 Intron maturase, type II family protein (.1) Potri.006G043650 [exp] 40 / 0.0001 AT5G04050 742 / 0.0 RNA-directed DNA polymerase (reverse transcriptase) (.1), RNA-directed DNA polymerase (reverse transcriptase) (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017037 pacid=23172975 polypeptide=Lus10017037 locus=Lus10017037.g ID=Lus10017037.BGIv1.0 annot-version=v1.0 ATGGTGTCTGATTCATTAGAATGTCAACGCGAGGATAATTTTGGAGCTACAACATATGGAATTGCATATAGTGGCTTAAGCTTGTTATCATTAGCAAGAA TCACCAGTGAGGGACGGCCTTGCAATTGTTTTGTTATGGGGTGTTCAGCTGCAGCACCAGCTGTGTATACTCTACATGTAATGGAAAGGCAGAAGTTTCC TGGATGGAAGACAGGATTTTCAACTTGCATTCATCCCAGTTTGAATAAACGCCGAATGGGGTTGTGTGAAAAACACTTGAAGGATTTGTATCTTGGTCAA ATATCACTTCAGTCTGTAGATTTCGGTTCGTGGAAATGA
AA sequence Show only first row Show all	>Lus10017037 pacid=23172975 polypeptide=Lus10017037 locus=Lus10017037.g ID=Lus10017037.BGIv1.0 annot-version=v1.0 MVSDSLECQREDNFGATTYGIAYSGLSLLSLARITSEGRPCNCFVMGCSAAAPAVYTLHVMERQKFPGWKTGFSTCIHPSLNKRRMGLCEKHLKDLYLGQ ISLQSVDFGSWK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G74350			Intron maturase, type II famil...		Lus10017037 [exp]	0	1
AT2G25660		EMB2410	embryo defective 2410 (.1)		Lus10022111 [exp]	6.2	0.7700
AT2G48060			unknown protein		Lus10035352 [exp]	6.3	0.7205
AT1G26930			Galactose oxidase/kelch repeat...		Lus10024239 [exp]	15.3	0.7529
AT5G02250		ATMTRNASEII, RN...	ribonucleotide reductase 1, EM...		Lus10010842 [exp]	15.9	0.7439
AT3G44670			Disease resistance protein (TI...		Lus10015465 [exp]	17.5	0.7346
AT5G66550			Maf-like protein (.1)		Lus10040204 [exp]	18.1	0.7425
AT5G04050			RNA-directed DNA polymerase (r...		Lus10036278 [exp]	18.3	0.7407
AT2G30800		ATVT-1, HVT1	helicase in vascular tissue an...		Lus10001049 [exp]	24.0	0.6678
					Lus10005785 [exp]	24.9	0.7315
AT4G34660			SH3 domain-containing protein ...		Lus10028785 [exp]	28.6	0.6351

Compare expression of checked genes

Lus10017037 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.