Lus10017040 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47960 92 / 3e-23 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
AT3G17140 65 / 5e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G64620 42 / 9e-05 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017013 214 / 1e-71 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016318 205 / 4e-68 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10027947 112 / 3e-31 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016317 110 / 2e-30 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10000822 109 / 2e-30 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10021338 84 / 2e-21 AT1G47960 59 / 3e-12 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017076 85 / 7e-21 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10037792 80 / 8e-19 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017014 72 / 3e-17 AT1G47960 56 / 4e-11 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G063000 97 / 2e-25 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.009G083500 75 / 4e-17 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.003G122000 64 / 6e-13 AT5G64620 53 / 7e-09 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.008G102600 52 / 1e-08 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G109700 46 / 2e-06 AT1G47960 46 / 2e-06 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.006G134900 45 / 6e-06 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.010G209800 44 / 2e-05 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10017040 pacid=23172988 polypeptide=Lus10017040 locus=Lus10017040.g ID=Lus10017040.BGIv1.0 annot-version=v1.0
ATGGCAACAGTACTGATCACAACAAAACTCGCTAGTTTAGCCTTCATTTTCCTCGTGGTGGTCCTCATGATGTCCCATAACATATCACCAACAGTGGCAG
ACAAGGACTTCATCGTACAAACTTGCAACAATACCCCTTTCTCCAAAACTTGTGAGTCCGCGTTGCTTGCAGACCCTCGCGGCCTCAAGGCCACCGACGT
GACGTCGCTGGCCTTGGTATTGATCGACGCCGTACAGTCAAAGGGGCTGGAGATTTTGGAGGAGATACAAAAATTGCGAGTTACCAACCCTGAACTGGAG
AACCCGCTCCTGGATTGTTTCGATTCTTACGATTTCTTGGCCCACGACGATCACGACAAGGCAGTTCAAGCGGTGAGTAAAGGTAACCCCAAATTTGGAG
AGAACGCCATTCTCGACTCTCAAAGTCTGATACAAAACTGCGAGAATTCATTCAAAATCTCTGGAAAAAAGTTCCCCTTCACTAATCTCAACTCTGATGC
TGTTGAGATCACCGATGTAACCAGGGCCGTTATCCAAATGTTGTTATGA
AA sequence
>Lus10017040 pacid=23172988 polypeptide=Lus10017040 locus=Lus10017040.g ID=Lus10017040.BGIv1.0 annot-version=v1.0
MATVLITTKLASLAFIFLVVVLMMSHNISPTVADKDFIVQTCNNTPFSKTCESALLADPRGLKATDVTSLALVLIDAVQSKGLEILEEIQKLRVTNPELE
NPLLDCFDSYDFLAHDDHDKAVQAVSKGNPKFGENAILDSQSLIQNCENSFKISGKKFPFTNLNSDAVEITDVTRAVIQMLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10017040 0 1
AT5G42170 SGNH hydrolase-type esterase s... Lus10003720 5.8 0.7640
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Lus10013925 10.2 0.7107
AT3G19850 Phototropic-responsive NPH3 fa... Lus10029070 14.8 0.6687
AT5G52260 MYB ATMYB19 myb domain protein 19 (.1) Lus10005739 16.4 0.6912
AT5G52260 MYB ATMYB19 myb domain protein 19 (.1) Lus10027456 19.4 0.6954
Lus10042413 20.9 0.6529
AT4G21390 B120 S-locus lectin protein kinase ... Lus10032836 22.4 0.6618
Lus10010827 23.2 0.6618
AT1G15550 ATGA3OX1, GA4 GA REQUIRING 4, ARABIDOPSIS TH... Lus10013135 24.0 0.6618
Lus10039269 24.0 0.6025

Lus10017040 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.