Plant FIBer expression Database

Lus10017043 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52730 91 / 2e-26 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021364
[exp]
122 / 1e-38 AT3G52730 91 / 2e-26 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Lus10022716
[exp]
115 / 5e-36 AT3G52730 94 / 1e-27 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Lus10014198
[exp]
114 / 1e-35 AT3G52730 94 / 2e-27 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G188700
[exp]
89 / 1e-25 AT3G52730 122 / 2e-38 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Potri.009G149300
[exp]
88 / 4e-25 AT3G52730 117 / 2e-36 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Representative CDS sequence
>Lus10017043 pacid=23172951 polypeptide=Lus10017043 locus=Lus10017043.g ID=Lus10017043.BGIv1.0 annot-version=v1.0
ATGGAGCACATACAGCGAAGGCGTCAAGGTGGCCTCTTTGAAGGGATCTATAAGGTTTTCATGCGCCGTACCTCCGTCTACGCTACCTTCGTCCTCGCCG
GTGCTTTCTTCGGTGAACGGGCTGTGGATTATGGAGTTCATAAGCTGTGGGAACACAACAATGTTGGGGTACTGCTCTAG
AA sequence
>Lus10017043 pacid=23172951 polypeptide=Lus10017043 locus=Lus10017043.g ID=Lus10017043.BGIv1.0 annot-version=v1.0
MEHIQRRRQGGLFEGIYKVFMRRTSVYATFVLAGAFFGERAVDYGVHKLWEHNNVGVLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52730 ubiquinol-cytochrome C reducta... Lus10017043
[exp]
0 1
AT1G07960 ATPDIL5-1 PDI-like 5-1 (.1.2.3) Lus10011641
[exp]
2.6 0.8124
AT5G61310 Cytochrome c oxidase subunit V... Lus10002429
[exp]
7.2 0.7986
AT5G61310 Cytochrome c oxidase subunit V... Lus10025028
[exp]
9.8 0.7840
AT1G23750 Nucleic acid-binding, OB-fold-... Lus10013010
[exp]
11.0 0.7820
AT1G09330 ECHIDNA, ECH unknown protein Lus10004514
[exp]
11.4 0.7937
AT5G41685 Mitochondrial outer membrane t... Lus10001641
[exp]
18.6 0.7340
AT3G01390 AVMA10, VMA10 vacuolar membrane ATPase 10 (.... Lus10029418
[exp]
19.1 0.7303
AT3G59280 TXR1 THAXTOMIN A RESISTANT 1, Prote... Lus10043207
[exp]
19.4 0.7813
AT5G54750 Transport protein particle (TR... Lus10028720
[exp]
19.9 0.7626
AT1G69980 unknown protein Lus10010734
[exp]
20.1 0.7796

Lus10017043 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.