Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03840 108 / 8e-32 TFL-1, TFL1 TERMINAL FLOWER 1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT2G27550 103 / 1e-29 ATC centroradialis (.1) AT5G62040 91 / 9e-25 BFT brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT1G65480 76 / 1e-18 FT FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT4G20370 66 / 8e-15 TSF TWIN SISTER OF FT, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT1G18100 55 / 8e-11 MFT, E12A11 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021372 [exp] 136 / 2e-42 AT5G03840 267 / 1e-92 TERMINAL FLOWER 1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10019518 [exp] 101 / 2e-29 AT2G27550 140 / 2e-43 centroradialis (.1) Lus10020600 [exp] 102 / 3e-29 AT2G27550 263 / 3e-91 centroradialis (.1) Lus10043385 [exp] 101 / 1e-28 AT2G27550 259 / 2e-89 centroradialis (.1) Lus10004886 [exp] 100 / 7e-28 AT2G27550 267 / 2e-92 centroradialis (.1) Lus10027442 [exp] 99 / 8e-28 AT5G62040 248 / 4e-85 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10004884 [exp] 92 / 6e-25 AT2G27550 218 / 3e-73 centroradialis (.1) Lus10005753 [exp] 91 / 1e-24 AT5G62040 241 / 5e-82 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10013532 [exp] 86 / 9e-23 AT1G65480 278 / 6e-97 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G165100 [exp] 108 / 9e-32 AT2G27550 293 / 7e-103 centroradialis (.1) Potri.004G203900 [exp] 103 / 2e-29 AT2G27550 286 / 4e-100 centroradialis (.1) Potri.015G141300 [exp] 98 / 1e-27 AT5G62040 217 / 1e-73 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.008G077700 [exp] 79 / 3e-20 AT1G65480 257 / 8e-89 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.010G179900 [exp] 76 / 9e-20 AT1G65480 132 / 6e-41 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.010G179801 [exp] 76 / 1e-19 AT1G65480 133 / 3e-41 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.010G179700 [exp] 76 / 8e-19 AT1G65480 286 / 2e-100 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.015G041000 [exp] 53 / 4e-10 AT1G18100 291 / 2e-102 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01161 [flax] [poplar] PBP Phosphatidylethanolamine-binding protein
Representative CDS sequence Show only first row Show all	>Lus10017052 pacid=23172965 polypeptide=Lus10017052 locus=Lus10017052.g ID=Lus10017052.BGIv1.0 annot-version=v1.0 ATGCCGTCGACGGACATGACGGTTGTGTACGCAAATAACAAAGTTGTCTCCAACGGCCATGAGTTCCTCCCTTCCGCCGTCTCCTCTAGGCCCCGCGTCG ACGTCCACGGCGGCGACCTCAGAACATTCTTCACCCTCGTGATGACGGATCCGGATGTTCCAGGGCCTGGTGATCCTTTCCTTAGGGAGCACCTCCACTG GTATTCTTTCACTACTACTTGTGTATACGACTGCAGCTATTTTGTCATCCTCTGA
AA sequence Show only first row Show all	>Lus10017052 pacid=23172965 polypeptide=Lus10017052 locus=Lus10017052.g ID=Lus10017052.BGIv1.0 annot-version=v1.0 MPSTDMTVVYANNKVVSNGHEFLPSAVSSRPRVDVHGGDLRTFFTLVMTDPDVPGPGDPFLREHLHWYSFTTTCVYDCSYFVIL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G03840		TFL-1, TFL1	TERMINAL FLOWER 1, PEBP (phosp...		Lus10017052 [exp]	0	1
					Lus10001476 [exp]	7.7	0.7904
AT1G49740			PLC-like phosphodiesterases su...		Lus10041594 [exp]	17.9	0.7811
AT5G42650		CYP74A, AOS, DD...	DELAYED DEHISCENCE 2, CYTOCHRO...		Lus10021019 [exp]	27.4	0.7439
					Lus10010397 [exp]	28.2	0.7494
AT3G13790		ATCWINV1, ATBFR...	ARABIDOPSIS THALIANA CELL WALL...		Lus10037631 [exp]	32.9	0.5858
AT5G13240			transcription regulators (.1)		Lus10034638 [exp]	36.1	0.7396
					Lus10019564 [exp]	43.5	0.7354
					Lus10002411 [exp]	46.1	0.7321
AT5G13825			unknown protein		Lus10000042 [exp]	51.2	0.7296
					Lus10022145 [exp]	52.3	0.7290

Compare expression of checked genes

Lus10017052 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.