Lus10017074 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G17130 117 / 4e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G47960 57 / 3e-10 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
AT5G64620 47 / 2e-06 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037791 313 / 2e-110 AT3G17130 131 / 8e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10016319 176 / 4e-56 AT3G17130 151 / 8e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10002739 170 / 5e-54 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10003530 71 / 3e-15 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10002933 71 / 4e-15 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016318 59 / 5e-11 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10027947 58 / 2e-10 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10000822 57 / 4e-10 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016317 55 / 2e-09 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G102600 147 / 5e-45 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.009G083500 72 / 5e-16 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.010G063000 65 / 4e-13 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.005G007100 47 / 8e-07 AT1G09360 85 / 6e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.007G108301 44 / 2e-05 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10017074 pacid=23167486 polypeptide=Lus10017074 locus=Lus10017074.g ID=Lus10017074.BGIv1.0 annot-version=v1.0
ATGACAATCTCATTCACTCGTAAAATCCCTGTCCTATCACTAACCATTCTCTGCATCATCATTCCGACCGGCAGCGTCCAATCCACCGACGATCAAAATC
TGATCGACCAAGTATGCAAGAAGACCCCTTTCTACCGCCTCTTTCCCGACACTCTGCATTCTTCCGCCGCCAACACCACCACCACCTCAAAAGACGTCAA
GGGGATAGCTTCCAAGTTCAACGACGTCGTACTGTCGAACGCCACGGAGATGCTGGATTACATCCAGGGGAAGCTGAAGATCGCTGAGGATCCTAAGATA
GAGAAAGCTCTGGCGAATTGTGCGGAGCTCTACATTCCGGTGGTGAAGTACAATCTGCCTCAGGGGATCGACGCTTTCCTCAGGGGTTACTATGGCTTCA
CCAGGTACGCTTTCTCCGAGGCCGGAGATCAGGCAGACGCATGTGAGGGTAAATTTTCTGGCGGCGGCGGCGGAGGAGATGAGGTTAGTGCGAGGAGTAA
GGTGGGGAGTGAGTTGTGCGATGTTGCGGCGGCGATTGTTGGATTGTTGATCAAAGGCCGCAGATTTGTTAATCTCGTGTAA
AA sequence
>Lus10017074 pacid=23167486 polypeptide=Lus10017074 locus=Lus10017074.g ID=Lus10017074.BGIv1.0 annot-version=v1.0
MTISFTRKIPVLSLTILCIIIPTGSVQSTDDQNLIDQVCKKTPFYRLFPDTLHSSAANTTTTSKDVKGIASKFNDVVLSNATEMLDYIQGKLKIAEDPKI
EKALANCAELYIPVVKYNLPQGIDAFLRGYYGFTRYAFSEAGDQADACEGKFSGGGGGGDEVSARSKVGSELCDVAAAIVGLLIKGRRFVNLV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G17130 Plant invertase/pectin methyle... Lus10017074 0 1
AT4G39510 CYP96A12 "cytochrome P450, family 96, s... Lus10018159 2.8 0.8213
AT4G16490 ARM repeat superfamily protein... Lus10017563 6.2 0.8525
Lus10041371 6.5 0.8448
AT5G19790 AP2_ERF RAP2.11 related to AP2 11 (.1) Lus10041372 6.8 0.8471
AT3G21150 CO EIP6, BBX32 EMF1-Interacting Protein 1, B-... Lus10034830 10.8 0.8320
AT4G02380 SAG21, ATLEA5 Arabidopsis thaliana late embr... Lus10029634 14.7 0.8055
AT4G16490 ARM repeat superfamily protein... Lus10017562 16.6 0.8309
AT4G37260 MYB ATMYB73 myb domain protein 73 (.1) Lus10030336 16.7 0.8219
AT3G18750 ZIK5, WNK6, ATW... ARABIDOPSIS THALIANA WITH NO K... Lus10030229 17.1 0.8026
AT3G18490 Eukaryotic aspartyl protease f... Lus10032482 22.7 0.8264

Lus10017074 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.