Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006097 [exp] 108 / 1e-30 AT4G29090 43 / 8e-05 Ribonuclease H-like superfamily protein (.1) Lus10033089 [exp] 97 / 2e-24 ND / Lus10033071 [exp] 89 / 7e-22 ND 39 / 0.005 Lus10041736 [exp] 77 / 2e-18 ND 37 / 0.006 Lus10042896 [exp] 63 / 2e-12 AT3G60380 91 / 1e-18 unknown protein Lus10017303 [exp] 56 / 4e-11 ND / Lus10019746 [exp] 53 / 2e-09 ND / Lus10004549 [exp] 44 / 1e-05 AT3G07610 173 / 8e-49 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) Lus10033553 [exp] 42 / 4e-05 AT1G13340 107 / 6e-26 Regulator of Vps4 activity in the MVB pathway protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0219 [flax] [poplar] RNase_H PF00075 [flax] [poplar] RNase_H RNase H
Representative CDS sequence Show only first row Show all	>Lus10017075 pacid=23167406 polypeptide=Lus10017075 locus=Lus10017075.g ID=Lus10017075.BGIv1.0 annot-version=v1.0 ATGTCATCTCAGTCACGACGAACAGGACCTGGTGTGATGAGTTACTCACGGGGTTTGGAGGAAAGACGACCTTCCTGGAGTTTTTATGTTGACGCAGCTG TGCATGCCAATTCCGACGGTAAAGGCTTTGGCGCAATTGGTATGGTTCTTCGCAGAGCCTGTGGATCTTTGGTGTCGGCAACAGGCTGTGTAGTTCCTTC GATTACAGACCCCCTAATCCTGGAGTTTATGGCGGTTCGTCATGCATTGTTAGCAGCTCGCCCGAGATTTCAGGAGCCGATTAACATCTACTCTGACTCG TTAGAGACAGTTCGTCTAATCACGGGTGTTGATGACGACATCCGCACGGGTCAATTACCTCTTAGTTAA
AA sequence Show only first row Show all	>Lus10017075 pacid=23167406 polypeptide=Lus10017075 locus=Lus10017075.g ID=Lus10017075.BGIv1.0 annot-version=v1.0 MSSQSRRTGPGVMSYSRGLEERRPSWSFYVDAAVHANSDGKGFGAIGMVLRRACGSLVSATGCVVPSITDPLILEFMAVRHALLAARPRFQEPINIYSDS LETVRLITGVDDDIRTGQLPLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017075 [exp]	0	1
AT5G55570			unknown protein		Lus10008950 [exp]	2.6	0.9364
AT5G24120		ATSIG5, SIG5, S...	SIGMA FACTOR 5, sigma factor E...		Lus10014934 [exp]	3.5	0.9244
AT5G24120		ATSIG5, SIG5, S...	SIGMA FACTOR 5, sigma factor E...		Lus10038823 [exp]	4.2	0.9334
AT4G27030		FADA, FAD4	FATTY ACID DESATURASE 4, fatty...		Lus10037808 [exp]	7.1	0.9130
AT5G19855		AtRbcX2	homologue of cyanobacterial Rb...		Lus10030141 [exp]	7.5	0.9141
AT3G52740			unknown protein		Lus10017046 [exp]	7.7	0.9112
AT4G32480			Protein of unknown function (D...		Lus10006177 [exp]	8.5	0.9055
AT2G37970		SOUL-1	SOUL heme-binding family prote...		Lus10017193 [exp]	9.2	0.9097
AT4G32480			Protein of unknown function (D...		Lus10041046 [exp]	9.5	0.8956
AT2G24820		AtTic55, TIC55-...	translocon at the inner envelo...		Lus10042424 [exp]	11.0	0.8951

Compare expression of checked genes

Lus10017075 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.