Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47960 88 / 1e-21 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1) AT3G17140 57 / 5e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17150 56 / 5e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17130 54 / 2e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17152 45 / 3e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46930 45 / 7e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46940 44 / 1e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46960 42 / 6e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G64620 41 / 0.0001 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1) AT5G38610 39 / 0.001 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037792 [exp] 306 / 5e-108 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016317 [exp] 132 / 5e-39 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016318 [exp] 117 / 2e-33 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017013 [exp] 114 / 2e-32 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10027947 [exp] 113 / 1e-31 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10000822 [exp] 107 / 2e-29 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017040 [exp] 85 / 8e-21 AT1G47960 92 / 3e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10002738 [exp] 72 / 9e-16 AT1G47960 67 / 5e-14 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10002933 [exp] 68 / 2e-14 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G083500 [exp] 100 / 8e-27 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.010G063000 [exp] 97 / 2e-25 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.008G102600 [exp] 74 / 7e-17 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G044100 [exp] 55 / 2e-09 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G288500 [exp] 53 / 3e-09 AT1G47960 59 / 1e-11 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.007G108301 [exp] 53 / 6e-09 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.005G023100 [exp] 49 / 3e-07 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023201 [exp] 49 / 3e-07 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086600 [exp] 48 / 4e-07 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023050 [exp] 47 / 2e-06 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10017076 pacid=23167468 polypeptide=Lus10017076 locus=Lus10017076.g ID=Lus10017076.BGIv1.0 annot-version=v1.0 ATGGCGACTTCCACAGAGCTCGTCAATCCACTTACCGCCTTCGTCATATTTCTCATCGTCTTTCTAGTCTCCGCAGAAGCCAGCACTACTCCACTCATCA CGGGAACCTGCAAGCGAACTCCCGACTACGACCTCTGCGTCTCCGTGCTCTCCACGCGAGCCGCCAAGGCCACTAGCGTGAAATCCCTGGCGCTAGCGAT GATCCACGTGGTCGAGGCCAAAGCAAAAGCGACGTCGCTTCACATCAAGGAGCTGCTCAAAACGACGTCGTCGTTGGCTAAAGAGTTGAAGGAGCCGCTC CGAGCGTGTGATGGTAATTACGGGGTCATACTAGACTACGATGTCCCTGGAGCAGTGACGGAGGTGACGTACGGGAACCCGAATTTCGGGGTTGACTCGA TGGTTGACTCGGCGGGGGAGAGCGAGAGTTGCGAGGGACAGTTTGGCGGCCGGAAAGGTAGTAAGTCGCCGTTGACGAGTAGGAACGAGGATGTCCGGCG TGTGTCCCAGGTGGCGGCTGCTATCATCAGGAATATTGATGTTCGTTGA
AA sequence Show only first row Show all	>Lus10017076 pacid=23167468 polypeptide=Lus10017076 locus=Lus10017076.g ID=Lus10017076.BGIv1.0 annot-version=v1.0 MATSTELVNPLTAFVIFLIVFLVSAEASTTPLITGTCKRTPDYDLCVSVLSTRAAKATSVKSLALAMIHVVEAKAKATSLHIKELLKTTSSLAKELKEPL RACDGNYGVILDYDVPGAVTEVTYGNPNFGVDSMVDSAGESESCEGQFGGRKGSKSPLTSRNEDVRRVSQVAAAIIRNIDVR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10017076 [exp]	0	1
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10037792 [exp]	4.9	0.7949
AT1G58330		ZW2	transcription factor-related (...		Lus10025265 [exp]	5.7	0.7798
AT2G27180			unknown protein		Lus10008446 [exp]	8.9	0.7916
AT5G43260			chaperone protein dnaJ-related...		Lus10037022 [exp]	10.4	0.8158
AT4G35070			SBP (S-ribonuclease binding pr...		Lus10014118 [exp]	10.6	0.7853
AT3G60690			SAUR-like auxin-responsive pro...		Lus10015879 [exp]	11.1	0.8201
AT1G21065			unknown protein		Lus10016049 [exp]	24.7	0.8008
AT5G16550			unknown protein		Lus10003850 [exp]	26.9	0.7490
AT1G08315			ARM repeat superfamily protein...		Lus10039500 [exp]	27.6	0.7867
AT5G20650		COPT5	copper transporter 5 (.1)		Lus10022671 [exp]	28.1	0.7696

Compare expression of checked genes

Lus10017076 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.