Lus10017077 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G17152 72 / 3e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17150 61 / 7e-12 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17220 57 / 2e-10 ATPMEI2 pectin methylesterase inhibitor 2 (.1)
AT5G64620 52 / 1e-08 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
AT1G47960 49 / 2e-07 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
AT3G17130 44 / 1e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17230 44 / 2e-05 invertase/pectin methylesterase inhibitor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037793 267 / 2e-91 AT3G17152 74 / 5e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10016317 63 / 2e-12 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016318 62 / 5e-12 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10000822 62 / 5e-12 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10027947 61 / 1e-11 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10002738 57 / 4e-10 AT1G47960 67 / 5e-14 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10041650 55 / 2e-09 AT1G48020 85 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
Lus10003530 54 / 4e-09 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10002933 50 / 5e-08 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G083500 67 / 3e-14 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.010G209800 65 / 3e-13 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.010G063000 62 / 4e-12 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.008G102600 49 / 1e-07 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.002G191500 49 / 2e-07 AT2G31430 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.008G013400 47 / 1e-06 AT5G64620 66 / 8e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.007G068300 46 / 2e-06 AT4G00872 113 / 4e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G122000 46 / 2e-06 AT5G64620 53 / 7e-09 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.006G134900 45 / 4e-06 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.001G109700 45 / 5e-06 AT1G47960 46 / 2e-06 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10017077 pacid=23167434 polypeptide=Lus10017077 locus=Lus10017077.g ID=Lus10017077.BGIv1.0 annot-version=v1.0
ATGAAGATGCACAAGATTTCCACCCTCCTCCTCTTCTTCATCCCTCTCTTCCTTCACAAAGCAACGGGCGATCTGGCGTTGCTCGAAAAGACCTGCAAGA
GCAGCAGCAACTACACGCTCTGCTTCGCATCCCTCCAATCCGACCCTCGAACCGCAAAGGCTGCTGACGTCAAAGGGCTGGCTTCGATCGAGCTGGACAT
CACCTTGGCTAAGGCCAATGTCGCATTAGACCATGTTGCTAATTTGTTTAGGAATGCGACTGACCCGTATTTGTACCGTGCGTACGGGACCTGTGTCGAG
GAGTTTAGAGGAGCGGTCGCAGGTGCGGACTCCAGCCTTGCCGGTTCGATCTCTGGTTTGAAATCGGGGGATTATGCTGCGGCGAAGAGTGGGCTTGAGC
GCACCAAGGCCCATGTAGAGATGTGTCTGGAAGGGTTGGCGGGTGATAAGGGGCCGTTTACTGATGAGGCCCAGCTCGTGGATGGGCTGTCAAGTGTGGC
TATTAGCATCATTAGTTTGTTGCATTGA
AA sequence
>Lus10017077 pacid=23167434 polypeptide=Lus10017077 locus=Lus10017077.g ID=Lus10017077.BGIv1.0 annot-version=v1.0
MKMHKISTLLLFFIPLFLHKATGDLALLEKTCKSSSNYTLCFASLQSDPRTAKAADVKGLASIELDITLAKANVALDHVANLFRNATDPYLYRAYGTCVE
EFRGAVAGADSSLAGSISGLKSGDYAAAKSGLERTKAHVEMCLEGLAGDKGPFTDEAQLVDGLSSVAISIISLLH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G17152 Plant invertase/pectin methyle... Lus10017077 0 1
AT5G47670 CCAAT NF-YB6, L1L "nuclear factor Y, subunit B6"... Lus10028845 1.7 0.7312
AT1G55790 Domain of unknown function (DU... Lus10032900 7.1 0.7281
Lus10031263 7.3 0.6718
AT5G04885 Glycosyl hydrolase family prot... Lus10005706 7.7 0.7212
Lus10039943 8.7 0.7245
AT2G23945 Eukaryotic aspartyl protease f... Lus10019961 12.0 0.6942
AT3G18080 BGLU44 B-S glucosidase 44 (.1) Lus10017997 13.0 0.7007
AT2G30130 AS2 PCK1, LBD12, AS... PEACOCK 1, Lateral organ bound... Lus10005284 14.0 0.6931
AT2G26490 Transducin/WD40 repeat-like su... Lus10016289 14.3 0.7007
AT5G09360 LAC14 laccase 14 (.1) Lus10036070 15.4 0.7007

Lus10017077 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.