Lus10017083 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037800 0 / 1 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10017083 pacid=23167447 polypeptide=Lus10017083 locus=Lus10017083.g ID=Lus10017083.BGIv1.0 annot-version=v1.0
ATGCTCGCTATCGCTGTCTTACCCGAGTTTTTGACTTCGATAACGAACAGCCTTGGCACTACTGTGGATGTTCTCTCTGCTACCGAGGTGCTGCGCCTAA
CCAGGAATGGTGTTGGTATGATGCATACTTTTCCCATGAAGAGGATCCTACTAAGCGCTGGTGAGCTATGCATACTCACTCTCATTTCCATTACTGGTTT
GGTGTTGGTCGACACCAGCTCACCAACCCCAGCTGGTCTTGTGGTGAATTGTCTGTTGCTGCGTAGTCCAGCGGCCAAACAACTCCTCAAAGCAAGCAGT
CCCCCACCCGAAAATGTAGACGCACGGTTTGTTGATGCGCAGCAGTTTCAAGAATCTGCAAGTGGCCGTGTCAAACTGTAA
AA sequence
>Lus10017083 pacid=23167447 polypeptide=Lus10017083 locus=Lus10017083.g ID=Lus10017083.BGIv1.0 annot-version=v1.0
MLAIAVLPEFLTSITNSLGTTVDVLSATEVLRLTRNGVGMMHTFPMKRILLSAGELCILTLISITGLVLVDTSSPTPAGLVVNCLLLRSPAAKQLLKASS
PPPENVDARFVDAQQFQESASGRVKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10017083 0 1
AT1G80100 AHP6 histidine phosphotransfer prot... Lus10011487 8.7 0.6848
AT1G55460 C2H2ZnF DNA/RNA-binding protein Kin17,... Lus10012271 16.7 0.5887
Lus10005172 27.3 0.4948
AT3G01410 Polynucleotidyl transferase, r... Lus10032166 38.2 0.5831
AT3G07060 EMB1974 embryo defective 1974, NHL dom... Lus10022801 43.2 0.5572
Lus10000761 81.8 0.5079
Lus10018446 114.2 0.5157
AT5G03300 ADK2 adenosine kinase 2 (.1) Lus10023197 128.0 0.4705

Lus10017083 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.