Lus10017108 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G48090 184 / 1e-54 calcium-dependent lipid-binding family protein (.1)
AT4G17140 117 / 2e-31 pleckstrin homology (PH) domain-containing protein (.1), pleckstrin homology (PH) domain-containing protein (.2), pleckstrin homology (PH) domain-containing protein (.3)
AT5G24740 72 / 2e-15 Protein of unknown function (DUF1162) (.1), Protein of unknown function (DUF1162) (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037833 145 / 6e-41 AT1G48090 2202 / 0.0 calcium-dependent lipid-binding family protein (.1)
Lus10003007 108 / 4e-28 AT4G17140 3544 / 0.0 pleckstrin homology (PH) domain-containing protein (.1), pleckstrin homology (PH) domain-containing protein (.2), pleckstrin homology (PH) domain-containing protein (.3)
Lus10011036 108 / 5e-28 AT4G17140 3546 / 0.0 pleckstrin homology (PH) domain-containing protein (.1), pleckstrin homology (PH) domain-containing protein (.2), pleckstrin homology (PH) domain-containing protein (.3)
Lus10003835 58 / 2e-10 AT5G24740 1701 / 0.0 Protein of unknown function (DUF1162) (.1), Protein of unknown function (DUF1162) (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G100600 185 / 4e-55 AT1G48090 3782 / 0.0 calcium-dependent lipid-binding family protein (.1)
Potri.001G148800 108 / 5e-28 AT4G17140 3708 / 0.0 pleckstrin homology (PH) domain-containing protein (.1), pleckstrin homology (PH) domain-containing protein (.2), pleckstrin homology (PH) domain-containing protein (.3)
Potri.001G455600 56 / 1e-09 AT5G24740 3006 / 0.0 Protein of unknown function (DUF1162) (.1), Protein of unknown function (DUF1162) (.2)
PFAM info
Representative CDS sequence
>Lus10017108 pacid=23167458 polypeptide=Lus10017108 locus=Lus10017108.g ID=Lus10017108.BGIv1.0 annot-version=v1.0
ATGTCAGAGCAGTGGAAAAAGAACAAGAGGGTTGAGTTTATCAATCTCAAACATGGTGAGATGAAGGTCCTCCATTTGCTTCGAAGATATTTGGGGGAAT
ATGTTCATGGCCTGTCATCAGAGGCTTTACGTATAAGTGTTTGGAAGGGTGATGTGGTCCTCAAAGACTTGAAACTGAAGGCTGAGGCGTTAAATTCACT
CAATCTTCCAGTCACTGTAAAAGCTGGTTTTATCGGAACCATAACACTAAAGGTTCCCTGGAAAAGCTTAGGCAAGGAGCCTGTTATTGTTCTTGTTGAC
CGAGTCTTTGTTCTTGCTCATCCTGCACCGGATGACCGAACTCTCAAGGAGGAGGACAGGATAAAACTATTCGAAGCAAAACTTCAACAGATTGAGTGTG
CTGAGATTGAGCACACTTTTCTCGACTAG
AA sequence
>Lus10017108 pacid=23167458 polypeptide=Lus10017108 locus=Lus10017108.g ID=Lus10017108.BGIv1.0 annot-version=v1.0
MSEQWKKNKRVEFINLKHGEMKVLHLLRRYLGEYVHGLSSEALRISVWKGDVVLKDLKLKAEALNSLNLPVTVKAGFIGTITLKVPWKSLGKEPVIVLVD
RVFVLAHPAPDDRTLKEEDRIKLFEAKLQQIECAEIEHTFLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G48090 calcium-dependent lipid-bindin... Lus10017108 0 1
AT1G58230 binding (.1) Lus10042867 1.4 0.9812
AT1G48090 calcium-dependent lipid-bindin... Lus10037833 2.4 0.9778
AT2G46560 transducin family protein / WD... Lus10005975 3.0 0.9736
AT1G24300 GYF domain-containing protein ... Lus10035191 4.5 0.9680
AT1G58230 binding (.1) Lus10028167 6.0 0.9691
AT2G26890 KAM2, GRV2 KATAMARI2, GRAVITROPISM DEFECT... Lus10033077 7.3 0.9634
ATMG01360 ATMG01360.1, CO... cytochrome oxidase (.1) Lus10009204 7.7 0.9674
AT1G55860 UPL1 ubiquitin-protein ligase 1 (.1... Lus10032589 8.9 0.9664
AT1G48090 calcium-dependent lipid-bindin... Lus10017107 9.8 0.9571
AT2G13370 CHR5 chromatin remodeling 5 (.1) Lus10009712 10.4 0.9606

Lus10017108 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.