Lus10017112 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G48130 335 / 4e-118 ATPER1 1-cysteine peroxiredoxin 1 (.1)
AT5G06290 96 / 6e-24 2CPB, 2-CysPrxB ,2-Cys Prx B 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
AT3G11630 95 / 2e-23 Thioredoxin superfamily protein (.1)
AT3G52960 44 / 4e-05 Thioredoxin superfamily protein (.1)
AT3G26060 43 / 6e-05 ATPRXQ ,ATPRX Q peroxiredoxin Q, Thioredoxin superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018342 444 / 3e-161 AT1G48130 338 / 2e-119 1-cysteine peroxiredoxin 1 (.1)
Lus10008810 135 / 7e-41 AT1G48130 107 / 2e-30 1-cysteine peroxiredoxin 1 (.1)
Lus10016969 96 / 6e-24 AT5G06290 403 / 2e-143 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
Lus10021295 96 / 7e-24 AT5G06290 404 / 6e-144 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
Lus10033424 41 / 0.0003 AT3G26060 278 / 1e-95 peroxiredoxin Q, Thioredoxin superfamily protein (.1.2)
Lus10034892 41 / 0.0003 AT3G26060 281 / 6e-97 peroxiredoxin Q, Thioredoxin superfamily protein (.1.2)
Lus10003373 40 / 0.0005 AT3G52960 291 / 3e-100 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G099900 375 / 3e-132 AT1G48130 322 / 2e-111 1-cysteine peroxiredoxin 1 (.1)
Potri.006G204900 95 / 2e-23 AT5G06290 385 / 2e-136 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
Potri.016G072100 94 / 4e-23 AT5G06290 390 / 3e-138 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
Potri.018G063300 44 / 3e-05 AT3G26060 275 / 1e-94 peroxiredoxin Q, Thioredoxin superfamily protein (.1.2)
Potri.006G137500 42 / 8e-05 AT3G26060 286 / 5e-99 peroxiredoxin Q, Thioredoxin superfamily protein (.1.2)
Potri.013G102100 40 / 0.0005 AT3G52960 278 / 1e-95 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00578 AhpC-TSA AhpC/TSA family
CL0172 PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Representative CDS sequence
>Lus10017112 pacid=23167432 polypeptide=Lus10017112 locus=Lus10017112.g ID=Lus10017112.BGIv1.0 annot-version=v1.0
ATGCCTGGACTCACCATTGGGGACACCGTCCCAAATCTTGAAGTGGAGAGCACTCATGGAGTCATCAATCTCCACGACTTCTTCACCAATTCCTGGACCA
TCCTCTTTTCTCACCCCGGTGATTTCACGCCGGTGTGCACCACGGAACTAGGGAAGATGGCAGCTTATGCGCCGGAGTTTGAGAAGAGAGGGGTCAAACT
CCTGGGCTTGTCATGCGACGACGTTTTGTCTCATGTCGAGTGGATCAAGGACGTAGAAGCCTTCACCCCGGGGAGCAAGGTGACGTACCCAATCATCTCC
GATCCGAATCGGGATGTAATAAAGCAGCTGAACATGGTGGATCCCGACGAGAAAGATCCATCGGGGAACAACGTCCCTTCCCGTGCTCTGCATATTGTGG
GCCCTGATAAGAAGATAAAGCTGAGCTTTCTGTACCCGGCGAGCACGGGGAGGAACATGGAGGAAGTGATGAGGGTGGTGGAGTCGCTGCAGAGGGCGTC
GAAGCACAAGATAGCAACTCCGGCGGACTGGAAGCCAGGGGATGCGGTGGTGATATCTCCCAGCGTGTCCAATGAGGAGGCTGATAAGATGTTCCCCCAG
GGGTACAAGATTGCCGACCTCCCTTCCAAGAAAGGCTATCTCCGCTTTACTCATGTTGACTAG
AA sequence
>Lus10017112 pacid=23167432 polypeptide=Lus10017112 locus=Lus10017112.g ID=Lus10017112.BGIv1.0 annot-version=v1.0
MPGLTIGDTVPNLEVESTHGVINLHDFFTNSWTILFSHPGDFTPVCTTELGKMAAYAPEFEKRGVKLLGLSCDDVLSHVEWIKDVEAFTPGSKVTYPIIS
DPNRDVIKQLNMVDPDEKDPSGNNVPSRALHIVGPDKKIKLSFLYPASTGRNMEEVMRVVESLQRASKHKIATPADWKPGDAVVISPSVSNEEADKMFPQ
GYKIADLPSKKGYLRFTHVD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G48130 ATPER1 1-cysteine peroxiredoxin 1 (.1... Lus10017112 0 1
AT5G65590 DOF AtDof5,7 Dof-type zinc finger DNA-bindi... Lus10025707 8.1 0.8738
AT5G65590 DOF AtDof5,7 Dof-type zinc finger DNA-bindi... Lus10035955 13.5 0.8667
AT4G28365 AtENODL3 early nodulin-like protein 3 (... Lus10039852 14.3 0.8713
AT5G28237 Pyridoxal-5'-phosphate-depende... Lus10018358 18.3 0.8646
AT3G26660 AS2 LBD24 LOB domain-containing protein ... Lus10009567 24.3 0.8599
AT3G07750 3'-5'-exoribonuclease family p... Lus10012336 26.7 0.8506
AT5G36000 unknown protein Lus10004013 27.3 0.8573
AT1G01920 SET domain-containing protein ... Lus10019677 28.7 0.7251
AT3G52610 unknown protein Lus10014215 30.2 0.8551
AT1G22590 MADS AGL87 AGAMOUS-like 87 (.1.2) Lus10023294 33.0 0.8521

Lus10017112 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.