Lus10017118 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G10710 78 / 2e-16 RHS12 root hair specific 12 (.1)
AT5G49180 78 / 3e-16 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT5G27870 69 / 2e-13 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G05610 69 / 3e-13 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G06830 66 / 3e-12 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G14300 63 / 4e-11 ATPMEPCRC, ATPME26 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1)
AT5G04960 62 / 6e-11 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT4G15980 60 / 3e-10 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G62170 59 / 7e-10 VGDH2 VANGUARD 1 homolog 2 (.1)
AT1G53840 57 / 3e-09 ATPME1 pectin methylesterase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018335 375 / 5e-128 AT3G05610 446 / 3e-149 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10002976 76 / 2e-15 AT2G26450 429 / 2e-144 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10034859 66 / 4e-12 AT3G10710 561 / 0.0 root hair specific 12 (.1)
Lus10033399 63 / 3e-11 AT3G10710 606 / 0.0 root hair specific 12 (.1)
Lus10033466 60 / 3e-10 AT3G05610 556 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10039927 59 / 7e-10 AT2G26450 598 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10020909 59 / 9e-10 AT3G05610 547 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10031469 57 / 2e-09 AT3G05610 442 / 4e-147 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10037457 56 / 8e-09 AT1G53840 234 / 1e-72 pectin methylesterase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G022900 79 / 1e-16 AT3G05610 593 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.010G010464 70 / 1e-13 AT5G27870 619 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.013G013400 69 / 3e-13 AT3G05610 580 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.010G247600 67 / 1e-12 AT3G10710 609 / 0.0 root hair specific 12 (.1)
Potri.003G021600 63 / 4e-11 AT4G33230 484 / 1e-165 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.018G051200 62 / 6e-11 AT2G26450 634 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.006G134700 59 / 6e-10 AT4G33230 608 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.008G011200 57 / 2e-09 AT3G10710 621 / 0.0 root hair specific 12 (.1)
Potri.001G209000 57 / 4e-09 AT4G33230 483 / 2e-165 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.015G128200 52 / 3e-08 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10017118 pacid=23167418 polypeptide=Lus10017118 locus=Lus10017118.g ID=Lus10017118.BGIv1.0 annot-version=v1.0
ATGCAGGTGAGGCAAAAGCCATTAATAGCAGGAGTGTCGATCATACTAGTGGTCGGCGTAGTCATCGGCGTAGTTGTCAGCGTCAAAAAGGGGAACGACG
GCCATTCCGGAAATGACGGAACTAACTCTGACGTGGACGCACTCTCCTCCGCTTCAAGGGCAGTAGCGGCAATTTGCGTCCACACGGACCACAAGCAGCA
CTGCGTCGACAGCATGAAATCCGTCTCCCAGAACGAATCCGCAACCCCAGTGGATTACATGAAGGCCGCCGTCAACTACACCATGGCCTATGTGGTCGAG
GCCGCCCGAAACGCTGCGTTGCTGCAGAACCAGACGTACAAGGGCAAGGGTAAAGACGCCAATATGACGCGGGCGCTGGCGTTCAAGTACTGCGGGGAGC
TGCTGGACCTGAGCGCGGACGAGCTAAGGACCACGTTGGCCCAGCTGGAGAATGTGAAGCAGACCGTGGATGTGATGGAGCTTGAGCAGGAGATTCGGAA
CTGGCTTAGCGCGGTTATGACGTACCATGGCACGTGCGTGGACGGGTTCGCTGGGGATGACGGTGGAGATGATCTGCATGAAGGGATCTCGAAAGGGTTG
GAGAACTCGACTCAGTTGACCAGCAACGCGCTTGCGATATTTGCGAGCGTGTCTGAGATTCTCACCGACTTCAACCTTACATCGTCCTTCCAGGTTGGGA
AGTTCTTAAACTACTACATAAACTGA
AA sequence
>Lus10017118 pacid=23167418 polypeptide=Lus10017118 locus=Lus10017118.g ID=Lus10017118.BGIv1.0 annot-version=v1.0
MQVRQKPLIAGVSIILVVGVVIGVVVSVKKGNDGHSGNDGTNSDVDALSSASRAVAAICVHTDHKQHCVDSMKSVSQNESATPVDYMKAAVNYTMAYVVE
AARNAALLQNQTYKGKGKDANMTRALAFKYCGELLDLSADELRTTLAQLENVKQTVDVMELEQEIRNWLSAVMTYHGTCVDGFAGDDGGDDLHEGISKGL
ENSTQLTSNALAIFASVSEILTDFNLTSSFQVGKFLNYYIN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G10710 RHS12 root hair specific 12 (.1) Lus10017118 0 1
Lus10013380 2.8 0.8298
AT3G27810 MYB AtMYB3, ATMYB21 ARABIDOPSIS THALIANA MYB DOMA... Lus10022259 4.4 0.8860
Lus10006897 4.6 0.7989
AT4G33985 Protein of unknown function (D... Lus10027898 19.0 0.7350
AT5G49290 ATRLP56 receptor like protein 56 (.1) Lus10027821 21.7 0.7218
AT2G21100 Disease resistance-responsive ... Lus10034473 24.5 0.7245
AT3G14880 unknown protein Lus10039196 24.7 0.7345
Lus10017290 29.8 0.6997
AT2G32885 Rapid alkalinization factor (R... Lus10000923 29.9 0.7012
AT5G14180 MPL1 Myzus persicae-induced lipase ... Lus10015158 39.9 0.6949

Lus10017118 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.