Lus10017119 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33230 269 / 7e-87 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT2G26450 268 / 4e-86 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G05610 265 / 1e-84 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT5G27870 263 / 3e-83 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT5G04960 255 / 7e-82 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G10710 255 / 9e-82 RHS12 root hair specific 12 (.1)
AT3G14310 250 / 1e-79 ATPME3 pectin methylesterase 3 (.1)
AT5G49180 249 / 2e-79 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT5G51490 245 / 2e-78 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT1G53830 245 / 8e-78 ATPME2 pectin methylesterase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018335 481 / 1e-169 AT3G05610 446 / 3e-149 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10027656 275 / 2e-91 AT4G33230 499 / 6e-174 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10039927 276 / 3e-89 AT2G26450 598 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10003968 271 / 9e-88 AT5G49180 456 / 3e-155 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10023775 270 / 2e-87 AT5G49180 454 / 3e-154 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10009110 261 / 1e-84 AT1G23200 501 / 1e-173 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10028536 246 / 9e-83 AT3G60730 322 / 6e-109 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10006103 254 / 2e-82 AT2G45220 592 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10038917 255 / 5e-82 AT2G45220 630 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G209000 309 / 7e-103 AT4G33230 483 / 2e-165 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.003G021600 307 / 4e-102 AT4G33230 484 / 1e-165 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.018G051200 298 / 5e-98 AT2G26450 634 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.006G134700 295 / 6e-97 AT4G33230 608 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.003G021300 287 / 2e-94 AT4G33230 459 / 5e-156 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.001G209200 282 / 2e-92 AT5G49180 459 / 2e-156 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.010G010464 267 / 3e-86 AT5G27870 619 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.010G109400 256 / 1e-82 AT1G23200 579 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.002G145500 255 / 3e-82 AT2G45220 670 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.014G067100 254 / 4e-82 AT2G45220 691 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF01095 Pectinesterase Pectinesterase
Representative CDS sequence
>Lus10017119 pacid=23167442 polypeptide=Lus10017119 locus=Lus10017119.g ID=Lus10017119.BGIv1.0 annot-version=v1.0
ATGTACGGTGATGGTCCACGTAAGACCATCGTTACTGGACGGAAGAGCTTCAAGGATGGTGTCCCCACTTACGGCACTGCCTCCTTCTCAGGAGCAATAG
GCCACCAAGCAGTAGCCCTCAGAGTCCAATCCGACCGTTCATCTTTCTACAACTGCAGAATGGACGGCTACCAAGACACCCTCTACCAACAAGCCCACTA
CCAATTCTACCGCAACTGCGTCATCTCCGGTACCGTCGACTTCATCTTCGGCGACTCCTCAGCCCTCGTCCAGAACTGCCTCATCATCGTCCGCATGCCC
ATGCAAGGTCAGCAGACCACCGTCACCGCCCAGGGCAAACAAGACAAGAACGAGGTCACCGGACTCGTCATCCAGAACTGCAAGATCGTACCCGAAGCCA
AACTCGCGCCGGTCACCGCCAAGTTCCCATCTTTCCTAGGAAGGCCGTGGAAGCAGTACTCGATGACGATTGTGATGGAGTCTATCATCGGAGGGTTCAT
AAGCCCTCTTGGTTGGATGCCGTGGCAAGGGAGCATGTACCTGGACACGTTGTTTTATGGGGAGTATGGGAACAAGGGACCCGGGTCGGGTACGGGCGGG
CGGGTCAACTGGAAAGGGTACCATGTGTTGACCCAGAAGGCTCAGGTTTTGAAGTATACGGCGGGGCCTTTCCTTGCTGCTTCTCAGTGGTTGCCGGCGG
CTGGGATTCCGTTCATTTCTGGCCTCCGGTATCCTTAG
AA sequence
>Lus10017119 pacid=23167442 polypeptide=Lus10017119 locus=Lus10017119.g ID=Lus10017119.BGIv1.0 annot-version=v1.0
MYGDGPRKTIVTGRKSFKDGVPTYGTASFSGAIGHQAVALRVQSDRSSFYNCRMDGYQDTLYQQAHYQFYRNCVISGTVDFIFGDSSALVQNCLIIVRMP
MQGQQTTVTAQGKQDKNEVTGLVIQNCKIVPEAKLAPVTAKFPSFLGRPWKQYSMTIVMESIIGGFISPLGWMPWQGSMYLDTLFYGEYGNKGPGSGTGG
RVNWKGYHVLTQKAQVLKYTAGPFLAASQWLPAAGIPFISGLRYP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G33230 Plant invertase/pectin methyle... Lus10017119 0 1

Lus10017119 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.