Lus10017123 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32070 447 / 1e-160 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 428 / 4e-153 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT5G10960 422 / 1e-150 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G15920 352 / 1e-122 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT3G44260 285 / 2e-96 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G22250 280 / 1e-94 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G06450 166 / 3e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G61470 129 / 1e-35 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44240 122 / 1e-33 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 119 / 2e-31 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018330 566 / 0 AT2G32070 444 / 3e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10003635 428 / 5e-153 AT2G32070 435 / 6e-156 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10036291 427 / 1e-152 AT2G32070 432 / 9e-155 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10034180 293 / 9e-100 AT5G22250 410 / 4e-146 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10004212 277 / 2e-93 AT3G44260 336 / 1e-116 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10021304 275 / 2e-92 AT5G22250 335 / 8e-116 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10016980 271 / 5e-90 AT5G22250 332 / 8e-114 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10007771 159 / 7e-47 AT1G61470 170 / 5e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10042746 158 / 1e-46 AT5G10960 150 / 2e-43 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G262500 496 / 1e-179 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G020900 495 / 1e-179 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G046700 475 / 1e-171 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 471 / 5e-170 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.006G187200 397 / 1e-140 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 298 / 8e-102 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 287 / 2e-97 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G073000 281 / 5e-95 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G205600 276 / 1e-92 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G040400 235 / 5e-77 AT5G22250 253 / 4e-84 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10017123 pacid=23167472 polypeptide=Lus10017123 locus=Lus10017123.g ID=Lus10017123.BGIv1.0 annot-version=v1.0
ATGTCGATCATGTCGAAAGGTGATGACTCTATCCATATTCGGGAGGTGTGGAATGACAATCTGGAAGAGGAATTCGCTTTGATTCGTGAGGTTGTTGACC
TGTTCCCTTTTGTTGCGATGGATACTGAGTTCCCTGGTGTGGTCCTGCGACCTGTAGTGGTTTACAAGAACATCAATGATTACAACTACCTGACGTTGAA
GGCTAATGTGGATATGCTGAAATTGATCCAGTTGGGGCTCACTTTCTCGGACGACAAGGGGAATTTACCCACTTGCGGAACCGATGATGATAGGTTCTGC
ATTTGGCAGTTCAACTTCCGCGAGTTCAATGTCACCGAGGACATCTATGCTAGCGACTCGATTGAGCTGCTGCGCCAGTGCGGGATTGATTTCAAGAAGA
ACAACGAAAGGGGTATCGACGTCAGCCGGTTTGGTGAGCTTCTGATGTCCTCAGGGATTGTGTTGAACTCTGAGGTGCATTGGGTTACTTTCCACAGTGG
GTATGATTTCGGCTACTTACTCAAGCTCTTGACTTGCAAGAGCCTCCCGGACACTCAAGCTGGATTCTTCGACCTGATCAATATGTATTTCCCGATGGTG
TATGACATCAAGCACTTGATGAAGTTCTGCAACAACCTCCATGGCGGCTTGAACAAACTCGCCGAGTTGCTGGAGGTTGAAAGAGTCGGTGTTTGCCATC
AAGCCGGGTCGGATAGCTTGCTCACATCATGCACGTTTAGGAAGTTGAGGGATAATTACTTCAGTGGTTCAACAGAGAAGTATGCTGGTGTGTTGTATGG
TCTTGGTATTGAGAATGGCCAAAATACTAATTGA
AA sequence
>Lus10017123 pacid=23167472 polypeptide=Lus10017123 locus=Lus10017123.g ID=Lus10017123.BGIv1.0 annot-version=v1.0
MSIMSKGDDSIHIREVWNDNLEEEFALIREVVDLFPFVAMDTEFPGVVLRPVVVYKNINDYNYLTLKANVDMLKLIQLGLTFSDDKGNLPTCGTDDDRFC
IWQFNFREFNVTEDIYASDSIELLRQCGIDFKKNNERGIDVSRFGELLMSSGIVLNSEVHWVTFHSGYDFGYLLKLLTCKSLPDTQAGFFDLINMYFPMV
YDIKHLMKFCNNLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDNYFSGSTEKYAGVLYGLGIENGQNTN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32070 Polynucleotidyl transferase, r... Lus10017123 0 1
AT3G55960 Haloacid dehalogenase-like hyd... Lus10004810 1.4 0.9603
AT2G29420 GST25, ATGSTU7 GLUTATHIONE S-TRANSFERASE 25, ... Lus10040764 4.0 0.9497
AT2G38370 Plant protein of unknown funct... Lus10009099 4.0 0.9464
AT4G00755 F-box family protein (.1.2) Lus10015001 6.0 0.9477
AT3G55960 Haloacid dehalogenase-like hyd... Lus10002484 9.5 0.9438
AT3G22200 HER1, GABA-T, P... POLLEN-PISTIL INCOMPATIBILITY ... Lus10003810 10.6 0.9358
AT1G44170 ALDH4, ALDH3H1 aldehyde dehydrogenase 4, alde... Lus10042724 11.6 0.9265
AT3G14610 CYP72A7 "cytochrome P450, family 72, s... Lus10036823 11.8 0.9398
AT1G77280 Protein kinase protein with ad... Lus10039518 12.5 0.9294
AT1G55680 Transducin/WD40 repeat-like su... Lus10035667 13.4 0.9344

Lus10017123 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.