Lus10017127 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G25170 291 / 6e-101 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 269 / 7e-92 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 263 / 2e-84 unknown protein
AT1G80690 242 / 1e-81 PPPDE putative thiol peptidase family protein (.1)
AT1G47740 223 / 2e-73 PPPDE putative thiol peptidase family protein (.1.2)
AT5G47310 209 / 2e-68 PPPDE putative thiol peptidase family protein (.1)
AT4G17486 204 / 1e-66 PPPDE putative thiol peptidase family protein (.1.2)
AT4G25680 97 / 2e-24 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 96 / 5e-24 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 62 / 2e-11 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018326 390 / 2e-140 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Lus10005341 319 / 3e-112 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1)
Lus10041021 312 / 2e-109 AT5G25170 309 / 5e-108 PPPDE putative thiol peptidase family protein (.1)
Lus10042454 246 / 1e-82 AT1G80690 265 / 1e-89 PPPDE putative thiol peptidase family protein (.1)
Lus10026215 244 / 1e-81 AT1G80690 265 / 8e-90 PPPDE putative thiol peptidase family protein (.1)
Lus10032708 223 / 9e-74 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10003951 221 / 6e-73 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040485 216 / 7e-71 AT1G47740 272 / 6e-92 PPPDE putative thiol peptidase family protein (.1.2)
Lus10011291 214 / 2e-70 AT1G47740 270 / 3e-91 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G261500 300 / 3e-104 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.018G021700 297 / 3e-103 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.003G180400 259 / 2e-88 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
Potri.001G047800 253 / 7e-86 AT1G80690 298 / 2e-103 PPPDE putative thiol peptidase family protein (.1)
Potri.014G042300 233 / 2e-77 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.002G134200 231 / 4e-77 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 225 / 2e-74 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 221 / 4e-73 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 221 / 6e-73 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.003G080300 214 / 2e-70 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10017127 pacid=23167396 polypeptide=Lus10017127 locus=Lus10017127.g ID=Lus10017127.BGIv1.0 annot-version=v1.0
ATGTTGCCGAATAAGAAGAAGAAGGCGGGTACGGTGCCGGTTTACTTGAATGTTTATGATTTGACTCCCATGAATGGCTACGCTTACTGGGTCGGCCTTG
GAATCTACCACTCTGGCGTCCAAGTTCACGGAGTTGAATATGGTTTTGGAGCTCATGATCGTTCAACCACCGGGGTTTTCGAGGTTGAACCGAAGCAGTG
CCCTGGTTTCACTTTCAGGAAATCGATACTCATCGGCAGAACTGATCTCGGTACGAAAGAAGTTCGTTCGATGATGGAGAAACTGGCCAAAGAGTATTCT
GGGAATACCTACCACCTTATCACTAAGAACTGCAATCACTTCTGCAATGATGCCTGTGTCAAGCTAACTGCGAAATCCATTCCCAGCTGGGTTAACCGGC
TTGCTCGATTAGGTTTCCTTTGCAACTGCGTCCTTCCGGCAGAGCTGAATGGAGCGAAAGTGCGGCAAGTAAGATCGGGGGAGAGGGTGCAGCAAGTAGA
GAAGAAGAAGTTAAGGAGCCGTTCGAGTAGATTTGCATCTGCAACAACCAACACACCTACATTATCAAAAACTGCTTCAGGTTCTGCAATCAGTAGTCGT
TCTGGACAGAACTTGTGA
AA sequence
>Lus10017127 pacid=23167396 polypeptide=Lus10017127 locus=Lus10017127.g ID=Lus10017127.BGIv1.0 annot-version=v1.0
MLPNKKKKAGTVPVYLNVYDLTPMNGYAYWVGLGIYHSGVQVHGVEYGFGAHDRSTTGVFEVEPKQCPGFTFRKSILIGRTDLGTKEVRSMMEKLAKEYS
GNTYHLITKNCNHFCNDACVKLTAKSIPSWVNRLARLGFLCNCVLPAELNGAKVRQVRSGERVQQVEKKKLRSRSSRFASATTNTPTLSKTASGSAISSR
SGQNL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G25170 PPPDE putative thiol peptidase... Lus10017127 0 1
AT5G39050 PMAT1 phenolic glucoside malonyltran... Lus10020721 4.5 0.6694
AT2G31230 AP2_ERF ATERF15 ethylene-responsive element bi... Lus10022935 5.5 0.6601
AT5G25170 PPPDE putative thiol peptidase... Lus10018326 9.7 0.6910
AT1G25250 C2H2ZnF ATIDD16 indeterminate(ID)-domain 16 (.... Lus10031314 10.4 0.6974
AT4G38520 Protein phosphatase 2C family ... Lus10025076 16.9 0.5687
AT5G47750 PK5, D6PKL2 D6 protein kinase like 2 (.1) Lus10016629 24.8 0.6531
AT3G27750 EMB3123 EMBRYO DEFECTIVE 3123, unknown... Lus10025805 27.3 0.6896
AT1G06510 unknown protein Lus10031457 28.9 0.6005
AT5G47840 AMK2 adenosine monophosphate kinase... Lus10003504 31.3 0.6140
AT5G23530 ATCXE18 carboxyesterase 18 (.1) Lus10039162 35.6 0.6548

Lus10017127 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.