Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35120 162 / 1e-52 Single hybrid motif superfamily protein (.1) AT2G35370 114 / 3e-33 GDCH glycine decarboxylase complex H (.1) AT1G32470 112 / 1e-32 Single hybrid motif superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018319 [exp] 218 / 1e-74 AT2G35120 244 / 2e-84 Single hybrid motif superfamily protein (.1) Lus10030979 [exp] 110 / 5e-32 AT1G32470 254 / 4e-88 Single hybrid motif superfamily protein (.1) Lus10035374 [exp] 110 / 6e-32 AT1G32470 254 / 6e-88 Single hybrid motif superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G122500 [exp] 183 / 9e-61 AT2G35120 224 / 2e-76 Single hybrid motif superfamily protein (.1) Potri.012G123700 [exp] 180 / 9e-60 AT2G35120 217 / 2e-73 Single hybrid motif superfamily protein (.1) Potri.001G144800 [exp] 114 / 1e-33 AT1G32470 255 / 3e-88 Single hybrid motif superfamily protein (.1) Potri.003G089300 [exp] 112 / 9e-33 AT1G32470 260 / 3e-90 Single hybrid motif superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0105 [flax] [poplar] Hybrid PF01597 [flax] [poplar] GCV_H Glycine cleavage H-protein
Representative CDS sequence Show only first row Show all	>Lus10017133 pacid=23167449 polypeptide=Lus10017133 locus=Lus10017133.g ID=Lus10017133.BGIv1.0 annot-version=v1.0 ATGGCTTCTTCGCGGTTGTTGTGGGCTTCCAAGGCCGCTTCTTTCCTCAGGATCTCCGTTCCCCACAGGGGATTCGCTTCTGAACTGCCGGAGATTGGTA CGGAAGTTACCCAGGGAAATGGTTTCGGGGCAGTTGAAAGCGTCAAGGCTACCAGCGATATCAATTCTCCGGTTTCTGGCAAAGTAGTGGAAGTAAATGA GGAGCTGAACAGTAGCCCCGGTTTGGTGAATTCGAGCCCGTATGAGAAAGGGTGGATCATGAAGGTGGAAATGAAGGATGCTTCTGAGCTGGAGAGCTTA AAGGATTCAGACAGCTACTCCAAGTTCTGCGATGAAGAAGATGCCAAGCATTAG
AA sequence Show only first row Show all	>Lus10017133 pacid=23167449 polypeptide=Lus10017133 locus=Lus10017133.g ID=Lus10017133.BGIv1.0 annot-version=v1.0 MASSRLLWASKAASFLRISVPHRGFASELPEIGTEVTQGNGFGAVESVKATSDINSPVSGKVVEVNEELNSSPGLVNSSPYEKGWIMKVEMKDASELESL KDSDSYSKFCDEEDAKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G35120			Single hybrid motif superfamil...		Lus10017133 [exp]	0	1
AT2G46890			Protein of unknown function (D...		Lus10010291 [exp]	5.7	0.9066
AT3G51490		TMT3	tonoplast monosaccharide trans...		Lus10012709 [exp]	9.5	0.8907
AT3G23000		PKS7, ATSRPK1, ...	SNF1-RELATED PROTEIN KINASE 3....		Lus10039404 [exp]	11.2	0.8858
AT3G51780		ATBAG4	BCL-2-associated athanogene 4 ...		Lus10027822 [exp]	15.9	0.8959
AT2G30490		REF3, CYP73A5, ...	REDUCED EPRDERMAL FLUORESCENCE...		Lus10035011 [exp]	16.1	0.9047
AT5G17820			Peroxidase superfamily protein...		Lus10013631 [exp]	16.3	0.9015
AT2G30490		REF3, CYP73A5, ...	REDUCED EPRDERMAL FLUORESCENCE...		Lus10019110 [exp]	18.5	0.9064
AT1G08250		AtADT6, ADT6	Arabidopsis thaliana arogenate...		Lus10020549 [exp]	25.2	0.9035
AT2G40320		TBL33	TRICHOME BIREFRINGENCE-LIKE 33...		Lus10007529 [exp]	27.5	0.8965
AT5G48930		HCT	hydroxycinnamoyl-CoA shikimate...		Lus10002321 [exp]	27.7	0.8975

Compare expression of checked genes

Lus10017133 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.