Lus10017148 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20500 179 / 3e-59 Glutaredoxin family protein (.1)
AT1G77370 130 / 7e-40 Glutaredoxin family protein (.1)
AT5G63030 97 / 6e-27 GRXC1 glutaredoxin C1, Thioredoxin superfamily protein (.1)
AT5G40370 94 / 1e-25 GRXC2 glutaredoxin C2, Glutaredoxin family protein (.1.2)
AT4G28730 89 / 3e-23 GrxC5 glutaredoxin C5, Glutaredoxin family protein (.1)
AT2G20270 89 / 6e-23 Thioredoxin superfamily protein (.1.2)
AT4G15700 67 / 3e-15 Thioredoxin superfamily protein (.1)
AT3G21460 66 / 7e-15 Glutaredoxin family protein (.1)
AT4G15690 66 / 1e-14 Thioredoxin superfamily protein (.1)
AT4G15680 65 / 1e-14 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021590 243 / 2e-84 AT5G20500 180 / 1e-59 Glutaredoxin family protein (.1)
Lus10028355 129 / 2e-39 AT1G77370 171 / 2e-56 Glutaredoxin family protein (.1)
Lus10022253 107 / 4e-31 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2)
Lus10013089 107 / 8e-31 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2)
Lus10042104 94 / 2e-25 AT5G63030 177 / 1e-58 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Lus10001237 93 / 3e-25 AT5G63030 171 / 2e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Lus10022844 89 / 9e-23 AT4G28730 177 / 3e-57 glutaredoxin C5, Glutaredoxin family protein (.1)
Lus10011915 70 / 1e-15 AT4G28730 154 / 4e-48 glutaredoxin C5, Glutaredoxin family protein (.1)
Lus10012815 66 / 1e-14 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G133400 188 / 1e-62 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1)
Potri.007G017300 131 / 3e-40 AT1G77370 163 / 8e-53 Glutaredoxin family protein (.1)
Potri.012G082800 98 / 3e-27 AT5G63030 155 / 6e-50 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Potri.002G254100 96 / 9e-26 AT4G28730 176 / 2e-56 glutaredoxin C5, Glutaredoxin family protein (.1)
Potri.015G078900 93 / 5e-25 AT5G63030 171 / 3e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Potri.001G347700 89 / 6e-24 AT5G40370 158 / 1e-51 glutaredoxin C2, Glutaredoxin family protein (.1.2)
Potri.002G208500 67 / 2e-15 AT3G62950 171 / 5e-57 Thioredoxin superfamily protein (.1)
Potri.014G134200 67 / 2e-15 AT3G62950 169 / 4e-56 Thioredoxin superfamily protein (.1)
Potri.008G214500 65 / 2e-14 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1)
Potri.001G325800 64 / 7e-14 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00462 Glutaredoxin Glutaredoxin
Representative CDS sequence
>Lus10017148 pacid=23167430 polypeptide=Lus10017148 locus=Lus10017148.g ID=Lus10017148.BGIv1.0 annot-version=v1.0
ATGGCCAAAGTTTCGTCGATATTCGCAGTTATTGCAACTCTGGCAGCTATAGCTGCGGTATCCTTTAGCTTGCCATCGGTATCTGCCGCTTCTCCAGAGA
CTGCTTTTGTCAAAAAGACCATCTCCTCTCACCAGATTGTTATATTTTCCAAGTCCTATTGCCCATACTGTAGGAGGGCTAAAGCTGTTTTCAAAGAGTT
GAACCAAACACCATATGTGGTTGAGCTTGATGAGAGAGAGGATGGGCATGACATCCAGGGTGCACTGGGTCAACTAATAGGGAAACGTACTGTACCTCAG
GTTTTCATAAAGGGTAAACACATTGGTGGCTCTGACGATACTGTTGAAGCATATGAGAATGGTGAACTGGCAACCCTTCTAGGGATTGACGTCGACGACG
AAAAGGATGATCTGTGA
AA sequence
>Lus10017148 pacid=23167430 polypeptide=Lus10017148 locus=Lus10017148.g ID=Lus10017148.BGIv1.0 annot-version=v1.0
MAKVSSIFAVIATLAAIAAVSFSLPSVSAASPETAFVKKTISSHQIVIFSKSYCPYCRRAKAVFKELNQTPYVVELDEREDGHDIQGALGQLIGKRTVPQ
VFIKGKHIGGSDDTVEAYENGELATLLGIDVDDEKDDL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G20500 Glutaredoxin family protein (.... Lus10017148 0 1
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Lus10023492 1.0 0.9527
AT3G60820 PBF1 N-terminal nucleophile aminohy... Lus10015867 1.4 0.9413
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Lus10040374 1.7 0.9406
AT5G67590 FRO1 FROSTBITE1, NADH-ubiquinone ox... Lus10019261 4.0 0.9289
AT5G17250 Alkaline-phosphatase-like fami... Lus10006806 4.5 0.9165
AT3G25220 FKBP15-1 FK506-binding protein 15 kD-1 ... Lus10003170 5.7 0.9198
AT5G16950 unknown protein Lus10021093 6.0 0.9173
AT4G26210 Mitochondrial ATP synthase sub... Lus10007995 6.2 0.9170
AT3G04830 Protein prenylyltransferase su... Lus10001785 7.0 0.9226
AT5G18800 Cox19-like CHCH family protein... Lus10033991 7.2 0.9185

Lus10017148 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.