Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G11970 91 / 1e-24 Protein of unknown function (DUF3511) (.1) AT2G19460 84 / 5e-22 Protein of unknown function (DUF3511) (.1) AT1G72720 74 / 8e-18 Protein of unknown function (DUF3511) (.1) AT3G62640 66 / 5e-15 Protein of unknown function (DUF3511) (.1) AT3G13910 64 / 3e-14 Protein of unknown function (DUF3511) (.1) AT2G47480 62 / 1e-13 Protein of unknown function (DUF3511) (.1) AT3G05725 56 / 6e-11 Protein of unknown function (DUF3511) (.1) AT4G09890 51 / 2e-09 Protein of unknown function (DUF3511) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021581 [exp] 176 / 3e-58 AT5G11970 97 / 4e-27 Protein of unknown function (DUF3511) (.1) Lus10027629 [exp] 146 / 3e-46 AT2G19460 110 / 2e-32 Protein of unknown function (DUF3511) (.1) Lus10011939 [exp] 142 / 8e-45 AT2G19460 109 / 6e-32 Protein of unknown function (DUF3511) (.1) Lus10008471 [exp] 85 / 4e-22 AT2G19460 95 / 1e-26 Protein of unknown function (DUF3511) (.1) Lus10006019 [exp] 81 / 7e-21 AT2G19460 88 / 9e-24 Protein of unknown function (DUF3511) (.1) Lus10031405 [exp] 57 / 3e-11 AT3G05725 71 / 6e-17 Protein of unknown function (DUF3511) (.1) Lus10010929 [exp] 56 / 5e-11 AT3G05725 71 / 3e-17 Protein of unknown function (DUF3511) (.1) Lus10028690 [exp] 50 / 3e-09 AT4G09890 71 / 1e-17 Protein of unknown function (DUF3511) (.1) Lus10033529 [exp] 49 / 9e-09 AT4G09890 70 / 2e-17 Protein of unknown function (DUF3511) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G147700 [exp] 104 / 6e-30 AT2G19460 96 / 2e-26 Protein of unknown function (DUF3511) (.1) Potri.001G197700 [exp] 94 / 1e-25 AT2G19460 78 / 1e-19 Protein of unknown function (DUF3511) (.1) Potri.003G043600 [exp] 86 / 2e-22 AT5G11970 89 / 5e-24 Protein of unknown function (DUF3511) (.1) Potri.006G225900 [exp] 82 / 4e-21 AT5G11970 90 / 2e-24 Protein of unknown function (DUF3511) (.1) Potri.002G065200 [exp] 63 / 6e-14 AT4G09890 84 / 9e-23 Protein of unknown function (DUF3511) (.1) Potri.005G195800 [exp] 62 / 1e-13 AT4G09890 81 / 1e-21 Protein of unknown function (DUF3511) (.1) Potri.014G123600 [exp] 62 / 2e-13 AT2G47480 93 / 5e-26 Protein of unknown function (DUF3511) (.1) Potri.005G019900 [exp] 55 / 7e-11 AT3G05725 63 / 3e-14 Protein of unknown function (DUF3511) (.1) Potri.010G140800 [exp] 51 / 2e-09 AT2G47480 62 / 2e-14 Protein of unknown function (DUF3511) (.1) Potri.007G077500 [exp] 50 / 4e-09 AT4G09890 80 / 3e-21 Protein of unknown function (DUF3511) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12023 [flax] [poplar] DUF3511 Domain of unknown function (DUF3511)
Representative CDS sequence Show only first row Show all	>Lus10017155 pacid=23167460 polypeptide=Lus10017155 locus=Lus10017155.g ID=Lus10017155.BGIv1.0 annot-version=v1.0 ATGGAAGACTTGAGATCCAAGTCCTGCTACGCCGATAACCGATCCTCCCAACTAGACCTCTACCAGTACGGCCCAGCAGCACCCCCCGCCGCTGGGGCTG GAGGTATGCAAGATCTCCGATGCTACAGCGCATCCTCCGTGTACCCATCTCAGAACAGCAGGCAACTGGAGATGAGTAGTAGCAAGGAGGATCCTAATAA GTTGAAGAAAGGAAATTCGATGAAGGGGTGGACGTTGAGTGACCCAGAGTTGCAGCGCAAGAAGCGGGTTGCGAGCTACAAGGCGTACACAGTGGAAGGG AAAGTCAAAGGTTCGTTCAAAAAGAGCTTCCGCTGGCTCAAGGATCGTTACTCCAGAGTCGTCTATGGATGGTGGTAG
AA sequence Show only first row Show all	>Lus10017155 pacid=23167460 polypeptide=Lus10017155 locus=Lus10017155.g ID=Lus10017155.BGIv1.0 annot-version=v1.0 MEDLRSKSCYADNRSSQLDLYQYGPAAPPAAGAGGMQDLRCYSASSVYPSQNSRQLEMSSSKEDPNKLKKGNSMKGWTLSDPELQRKKRVASYKAYTVEG KVKGSFKKSFRWLKDRYSRVVYGWW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G11970			Protein of unknown function (D...		Lus10017155 [exp]	0	1
AT5G42190		SKP1B, ASK2	Arabidopsis SKP-like 2, E3 ubi...		Lus10017282 [exp]	1.7	0.9347
AT2G25280			unknown protein		Lus10001950 [exp]	2.0	0.9263
AT5G42190		SKP1B, ASK2	Arabidopsis SKP-like 2, E3 ubi...		Lus10005610 [exp]	3.0	0.9281
AT4G25770			alpha/beta-Hydrolases superfam...		Lus10001320 [exp]	4.7	0.9291
AT3G58680		MBF1B, ATMBF1B	multiprotein bridging factor 1...		Lus10013686 [exp]	5.9	0.9182
AT3G20920			translocation protein-related ...		Lus10030136 [exp]	7.7	0.9066
AT4G12790			P-loop containing nucleoside t...		Lus10036411 [exp]	11.7	0.9166
AT2G43320			S-adenosyl-L-methionine-depend...		Lus10015953 [exp]	11.8	0.9250
AT1G25420			Regulator of Vps4 activity in ...		Lus10041442 [exp]	12.5	0.9082
AT1G12400			Nucleotide excision repair, TF...		Lus10006998 [exp]	13.6	0.8816

Compare expression of checked genes

Lus10017155 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.