Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34750 90 / 4e-24 SAUR-like auxin-responsive protein family (.1.2) AT1G75590 80 / 4e-20 SAUR-like auxin-responsive protein family (.1) AT5G10990 79 / 1e-19 SAUR-like auxin-responsive protein family (.1) AT1G19840 77 / 3e-19 SAUR-like auxin-responsive protein family (.1) AT2G37030 73 / 1e-17 SAUR-like auxin-responsive protein family (.1) AT2G21220 68 / 4e-16 SAUR-like auxin-responsive protein family (.1) AT3G12830 69 / 6e-16 SAUR-like auxin-responsive protein family (.1) AT3G53250 67 / 1e-15 SAUR-like auxin-responsive protein family (.1) AT1G56150 66 / 5e-15 SAUR-like auxin-responsive protein family (.1) AT1G79130 66 / 1e-14 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021130 [exp] 215 / 4e-74 AT4G34750 97 / 8e-27 SAUR-like auxin-responsive protein family (.1.2) Lus10033161 [exp] 87 / 6e-23 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1) Lus10034507 [exp] 86 / 1e-22 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1) Lus10012426 [exp] 82 / 8e-21 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1) Lus10026297 [exp] 71 / 2e-16 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1) Lus10042374 [exp] 70 / 2e-16 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1) Lus10026521 [exp] 68 / 1e-15 AT2G37030 139 / 8e-44 SAUR-like auxin-responsive protein family (.1) Lus10013808 [exp] 68 / 1e-15 AT2G37030 141 / 1e-44 SAUR-like auxin-responsive protein family (.1) Lus10012190 [exp] 67 / 3e-15 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G237000 [exp] 86 / 1e-22 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1) Potri.002G024500 [exp] 85 / 4e-22 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1) Potri.009G125900 [exp] 78 / 2e-19 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1) Potri.004G164300 [exp] 74 / 4e-18 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1) Potri.016G091500 [exp] 73 / 7e-18 AT2G37030 136 / 2e-42 SAUR-like auxin-responsive protein family (.1) Potri.006G126500 [exp] 72 / 3e-17 AT2G37030 131 / 1e-40 SAUR-like auxin-responsive protein family (.1) Potri.008G037900 [exp] 69 / 7e-16 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.010G224500 [exp] 67 / 2e-15 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 63 / 5e-14 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 62 / 9e-14 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10017179 pacid=23165854 polypeptide=Lus10017179 locus=Lus10017179.g ID=Lus10017179.BGIv1.0 annot-version=v1.0 ATGGCGTTCTCAATAAAGAGTTGTTATGAATGTGGCATTTGCAAAGTGGTGAAGCTGAGAAAAGTTACCAACTTGTGGCAGGAGGCCGGAGGAAGAGAGA AGAAACTTCCCCGAGACGTGCCGCCTGGCTATTTACCTGTCATGGTTGGGGAAGCTGGGAAAAGGTTTGTCATCAAAGCGGATCACTTGAACCATCCGAT TCTCAGGAAACTGCTAGACCAAGCATATGAGGAGCATGGTCGTAACAACAATGGTCTCTTGGCCATACCTTGCGACGAGCCTTCTTTTCGAGACATAATC CATTCGCTGACAGTCGGCGCAAAGAAACTCCGGTGTTAA
AA sequence Show only first row Show all	>Lus10017179 pacid=23165854 polypeptide=Lus10017179 locus=Lus10017179.g ID=Lus10017179.BGIv1.0 annot-version=v1.0 MAFSIKSCYECGICKVVKLRKVTNLWQEAGGREKKLPRDVPPGYLPVMVGEAGKRFVIKADHLNHPILRKLLDQAYEEHGRNNNGLLAIPCDEPSFRDII HSLTVGAKKLRC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34750			SAUR-like auxin-responsive pro...		Lus10017179 [exp]	0	1
AT3G49260		IQD21	IQ-domain 21 (.1.2.3)		Lus10018115 [exp]	24.9	0.7964
AT2G47500			P-loop nucleoside triphosphate...		Lus10010300 [exp]	57.8	0.7767
AT5G02440			unknown protein		Lus10040828 [exp]	65.2	0.7171
AT4G34500			Protein kinase superfamily pro...		Lus10023574 [exp]	65.5	0.7656
AT3G55990		TBL29, ESK1	TRICHOME BIREFRINGENCE-LIKE 29...		Lus10028974 [exp]	92.2	0.7627
AT4G18490			unknown protein		Lus10021779 [exp]	129.1	0.7429
AT2G30933			Carbohydrate-binding X8 domain...		Lus10020765 [exp]	140.9	0.7257
AT2G46690			SAUR-like auxin-responsive pro...		Lus10008845 [exp]	141.0	0.7194
AT3G54260		TBL36	TRICHOME BIREFRINGENCE-LIKE 36...		Lus10026066 [exp]	159.3	0.7186
AT5G60690	HD	IFL1, REV	REVOLUTA, INTERFASCICULAR FIBE...		Lus10000719 [exp]	183.5	0.7061

Compare expression of checked genes

Lus10017179 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.