Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09085 153 / 1e-49 Protein of unknown function (DUF962) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021128 [exp] 208 / 3e-71 AT3G09085 162 / 4e-53 Protein of unknown function (DUF962) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G110900 [exp] 171 / 2e-56 AT3G09085 147 / 2e-47 Protein of unknown function (DUF962) (.1) Potri.004G103400 [exp] 171 / 2e-56 AT3G09085 146 / 9e-47 Protein of unknown function (DUF962) (.1) Potri.006G096200 [exp] 167 / 3e-55 AT3G09085 153 / 2e-49 Protein of unknown function (DUF962) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06127 [flax] [poplar] DUF962 Protein of unknown function (DUF962)
Representative CDS sequence Show only first row Show all	>Lus10017182 pacid=23165862 polypeptide=Lus10017182 locus=Lus10017182.g ID=Lus10017182.BGIv1.0 annot-version=v1.0 ATGAATTTCAGGAGCATGGAGGAGTTCTGGGCGTTCTACATGAGCCAGCACTCGAAGCCCTGGACGAGGAGGTGGCACTTCGTGGGTACGCTCCTCAGCT TGCTGACTTTACTCTATGCGCTCTGCTTCAAATTGTGGGTCCTCTCTCTGGTGCCGGTTGTCGGGTACGGGTTCGCCTGGTACAGCCACTTCTTCGTGGA GCGGAATGTGCCGGCCACTTTCGGGCACCCGGTTTGGTCCTTAGTTTGTGATTACAGGATGTTTGGGTTGATGCTTACTGGGAAGATGGATAAAGAGATT AAGCGGCTCGGAAAACGCCCGGTGTTGCAGAGCTATTGA
AA sequence Show only first row Show all	>Lus10017182 pacid=23165862 polypeptide=Lus10017182 locus=Lus10017182.g ID=Lus10017182.BGIv1.0 annot-version=v1.0 MNFRSMEEFWAFYMSQHSKPWTRRWHFVGTLLSLLTLLYALCFKLWVLSLVPVVGYGFAWYSHFFVERNVPATFGHPVWSLVCDYRMFGLMLTGKMDKEI KRLGKRPVLQSY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09085			Protein of unknown function (D...		Lus10017182 [exp]	0	1
AT5G26990			Drought-responsive family prot...		Lus10015214 [exp]	2.2	0.8675
AT1G71340		AtGDPD4	glycerophosphodiester phosphod...		Lus10013777 [exp]	3.5	0.8491
AT1G22040			Galactose oxidase/kelch repeat...		Lus10020960 [exp]	7.9	0.8594
AT3G09085			Protein of unknown function (D...		Lus10021128 [exp]	8.7	0.8154
AT4G11680			Zinc finger, C3HC4 type (RING ...		Lus10006313 [exp]	11.5	0.8266
AT3G07870			F-box and associated interacti...		Lus10006403 [exp]	13.4	0.8279
AT2G02390		GST18, ATGSTZ1	GLUTATHIONE S-TRANSFERASE 18, ...		Lus10020519 [exp]	15.0	0.8251
AT3G61180			RING/U-box superfamily protein...		Lus10029582 [exp]	18.5	0.8260
AT3G27010	TCP	ATTCP20, PCF1, ...	ARABIDOPSIS THALIANA TEOSINTE ...		Lus10035193 [exp]	24.3	0.8174
AT1G78080	AP2_ERF	CAF1, RAP2.4, W...	wound induced dedifferentiatio...		Lus10033463 [exp]	27.1	0.8077

Compare expression of checked genes

Lus10017182 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.